3300017260: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in filtered seawater, 15 C, 29.4 psu salinity and 425 ?mol photons light - Favella taraikaensis Fe Narragansett Bay (MMETSP0434)

Overview

Basic Information

• IMG/M Taxon OID: 3300017260
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128947 | Gp0212234 | Ga0186522
• Sample Name: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in filtered seawater, 15 C, 29.4 psu salinity and 425 ?mol photons light - Favella taraikaensis Fe Narragansett Bay (MMETSP0434)
• Sequencing Status: Permanent Draft
• Sequencing Center: National Center for Genome Resources
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 34357746
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia	1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Atlantic Ocean
• Coordinates
  • Lat. (^o): 41.30051
  • Long. (^o): -71.71543
  • Alt. (m): N/A
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047709	Metagenome / Metatranscriptome	149	Y
F051179	Metagenome / Metatranscriptome	144	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0186522_117063	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia	666
Ga0186522_117778	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	621

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0186522_117063	Ga0186522_1170631	F047709	MKSFAFAGLTALALADKGSFPRDDSFHADCHVSAQFDGVSCDSLYALMDAEIRSWNSDTTSPSQGVYNLKEESVDDYIWSTRLTKNQKYTDDQLFEFASNDTGCAVTGRSRSQSMSYYDYSVNFCNLWNVYNGLNLTSYSVGKCGYPAKDPASTCAKY
Ga0186522_117778	Ga0186522_1177782	F051179	SSIRIMANIPRFTDKDFRNEGHEVDFDLRKVFDMPNIEQMIFFYTNFDKCRREIINYEEKRATPSMNKRHPKESKPEALALLRCHAQNLQFEPVCNDPFNDARECLFKMDGQMRICEPELNLFEECVHDPKSFARFQAMATPVQREARDYFSTIHRKNYFF