Basic Information | |
---|---|
Taxon OID | 3300017258 Open in IMG/M |
Scaffold ID | Ga0186356_129209 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from North Pacific Ocean in marine media K with soil extract, 18 C, 36 psu salinity and 435 ?mol photons light - Haptolina ericina CCMP 281 (MMETSP1096) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 674 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Pacific Ocean | |||||||
Coordinates | Lat. (o) | 49.6 | Long. (o) | -140.6166 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F043734 | Metagenome / Metatranscriptome | 155 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186356_1292091 | F043734 | GAGG | MFRMKQLGVPAMRWGGAFGAIGFFLLFEDLPQLILQTQYGNFPGWHGVAVAFGVIKDKSAEDA |
⦗Top⦘ |