Scaffold Ga0186462_108079

Overview

Basic Information

• Taxon OID: 3300017255
• Scaffold ID: Ga0186462_108079
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from English Channel in f/20 medium with seawater, no silicate, 18 C, 30 psu salinity and 314 ?mol photons light - Alexandrium tamarense CCMP 1771 (MMETSP0378)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 615
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: English Channel
• Coordinates
  • Lat. (^o): 50.6
  • Long. (^o): 4.25

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001028	Metagenome / Metatranscriptome	801	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186462_1080791	F001028	N/A	MPAGQMEVSEAAKSGDGSLEKVGIKVNGKFKSPVTNQTFDTKEALDLHLKYLHDPKKSSTLEE