Scaffold Ga0186341_115768

Overview

Basic Information

• Taxon OID: 3300017252
• Scaffold ID: Ga0186341_115768
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Northern Baffin Bay in L1 medium with seawater and antibiotics, 6 C, 36 psu salinity and 388 ?mol photons light - unclassified eukaryote CCMP 2098 (MMETSP0990)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 921
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Northern Baffin Bay
• Coordinates
  • Lat. (^o): 76.285
  • Long. (^o): -73.0575
  • Depth (m): 75

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021038	Metagenome / Metatranscriptome	220	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186341_1157681	F021038	N/A	MKVLSAPADKPKIVFHVAMMSLQNFGFFIMYYSLWIATPDAEICADTRFAEGFMALTCFLVAFLCVGMGFGGYTDDAAVFAVYWIAHAVPAVGGYTTCTFLIPMARFSDSGMACASLSPVIGTIVQSVYVVHAGLYWCYVGNMVSVTYFSFLKPSFDFTVKPVVALSALALAEALVFGKLVDIGAFEPLSLPSPKAKLFGLF