Scaffold Ga0186342_105686

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0186342_105686

Scaffold Ga0186342_105686

Overview

Basic Information
Taxon OID	3300017244 Open in IMG/M
Scaffold ID	Ga0186342_105686 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine eukaryotic communities from Northern Baffin Bay in L1 medium with seawater and antibiotics, 6 C, 36 psu salinity and 380 ?mol photons light - unclassified eukaryote CCMP 2098 (MMETSP0992)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	National Center for Genome Resources
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1660
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location Name	Northern Baffin Bay
Coordinates	Lat. (^o)	76.285	Long. (^o)	-73.0575	Alt. (m)		Depth (m)	75
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073111	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186342_1056861	F073111	N/A	MSPTDLTLLEEKEVSKIGLKAVQKKHWQKALAHSKYLEAIHFDKPPSPLNLWLESWRLDRLGEGLFNLGCDVKEDIIDLMESDAAALGMKLLEERRWKQATAQLLTVIRHYDFNDNTRNSAPSLVTWLASLKLQELDEPLKLLGVVELCDLGDMDDRELASLGLNKLQRKHWDMGMLQVLKAKSEARLDGKNDDPTFRAFLESWRLGRLGPVMGDLGAYVQQDLLDLEPNEYSLLKMRPLEAKRFEQAMIALEEEFQQWT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.