| Basic Information | |
|---|---|
| Taxon OID | 3300017236 Open in IMG/M |
| Scaffold ID | Ga0186218_1005916 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from unknown location in 1/8 Erdschreiber medium with filtered sea water, at 22 C, 35 psu salinity and 247 ?mol photons light - Rosalina sp. (MMETSP0190_2) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1361 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F073071 | Metatranscriptome | 120 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186218_10059161 | F073071 | N/A | MWQYVQKRHAGGGTVPPSPHPFLAKPDELPPIAPENVGRTGYGEIKGELKNIMGGPVDELNDFPADMGKLERGRWFPWSNRDDYPPMITTSAEQNQRIWNEMAMEQLLDHHPPHEVHASELPDYHYFSSINNELDHKLPADKAVTEVSAQYTRDKTDIPRFFRSGVPKLPLNEQDWYVPRSPDGRFDWKRNIKENGYSASLFDKRGWDRRYMLKLNVVNPPMHTTGLRQFAQMPTFFRTSEQPLPKRFARQFWASQFDKHVIFMGLYFGSLIYISSWGGHWRQLVWDNDPFNYDITFCAENRKKGGFHGII |
| ⦗Top⦘ |