| Basic Information | |
|---|---|
| Taxon OID | 3300017210 Open in IMG/M |
| Scaffold ID | Ga0186339_113755 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from northern Puget Sound, Washington in Ciliate medium, 15 C, 30 psu salinity and 103 ?mol photons light - Favella ehrenbergii Fehren 1 (MMETSP0123) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 718 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: northern Puget Sound, Washington | |||||||
| Coordinates | Lat. (o) | 48.634 | Long. (o) | -122.868 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019022 | Metagenome / Metatranscriptome | 232 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186339_1137551 | F019022 | N/A | KIKARMVFHITNYMRETNVWMIRKMRWILWGTFSFIPIYRNVYWDFLGRRVAWKDSLRGETEAEKEAAAVADRADWGYTPRYEGKYDFSIKTKKQAEQTRE |
| ⦗Top⦘ |