Scaffold Ga0186311_100153

Overview

Basic Information

• Taxon OID: 3300017204
• Scaffold ID: Ga0186311_100153
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in f/2 medium with seawater, no Na2SiO3, 25 C, 34 psu salinity and 599 ?mol photons light - Symbiodinium sp. Mp (MMETSP1123)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3014
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097454	Metatranscriptome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186311_1001531	F097454	N/A	CTQDHELSRHRAAQQVVFMPGWSAFAESAEAAVGVQSLGLVWPGTEPKASQGLEKIGFKRICEAVGAPTPPFTVLSEEDAPLVDLTDPEAKEACVQDFMKKVLDMNFSEKGLIKSIHGGGGKGTAHLHHPDQPDDVRRAVEKVITEMNRTDGIYFEQRVNTKGDGRFYQIELEVDGGTVADGGRFVWFNSGLQKVVEIGLSDDKIDLFMPQDLYQKSRKWAGDIAKMGNNNTRATMEALVFKNEKXXXXRRV