| Basic Information | |
|---|---|
| Taxon OID | 3300017183 Open in IMG/M |
| Scaffold ID | Ga0186609_101812 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Antarctic Ocean in L1 medium with seawater, 2 C, 33 psu salinity and 553 ?mol photons light - Mantoniella sp. CCMP1436 (MMETSP1468) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2137 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Mantoniella → Mantoniella antarctica | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Southern Ocean | |||||||
| Coordinates | Lat. (o) | -78.8333 | Long. (o) | 163.0 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029609 | Metagenome / Metatranscriptome | 187 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186609_1018123 | F029609 | GAGG | MKLDDFNHELPSASDAGLHVWVEVVGDDGDVDGQLIQL |
| ⦗Top⦘ |