NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017183

3300017183: Metatranscriptome of marine eukaryotic communities from Antarctic Ocean in L1 medium with seawater, 2 C, 33 psu salinity and 553 ?mol photons light - Mantoniella sp. CCMP1436 (MMETSP1468)



Overview

Basic Information
IMG/M Taxon OID3300017183 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212321 | Ga0186609
Sample NameMetatranscriptome of marine eukaryotic communities from Antarctic Ocean in L1 medium with seawater, 2 C, 33 psu salinity and 553 ?mol photons light - Mantoniella sp. CCMP1436 (MMETSP1468)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size25479904
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Mantoniella → Mantoniella antarctica1
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationSouthern Ocean
CoordinatesLat. (o)-78.8333Long. (o)163.0Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029609Metagenome / Metatranscriptome187Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186609_101812All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Mantoniella → Mantoniella antarctica2137Open in IMG/M
Ga0186609_110869Not Available738Open in IMG/M
Ga0186609_112255Not Available651Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186609_101812Ga0186609_1018123F029609MKLDDFNHELPSASDAGLHVWVEVVGDDGDVDGQLIQL
Ga0186609_110869Ga0186609_1108691F029609NHELPRTPDAVPNVWVEMVDDDGDVDGHLMIVDDWYWRWSLY
Ga0186609_112255Ga0186609_1122551F029609AQRWMKLDDFNHELPSASDAGLHVWVEVVGDDGDVDGQLMTVERAS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.