Scaffold Ga0186409_113801

Overview

Basic Information

• Taxon OID: 3300017179
• Scaffold ID: Ga0186409_113801
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Irish Sea in f/2 medium with seawater, 21 C, 33 psu salinity and 136 ?mol photons light - Isochrysis galbana CCMP 1323 (MMETSP0944)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 838
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Discoba → Heterolobosea → Tetramitia → Eutetramitia → Vahlkampfiidae → Naegleria → Naegleria gruberi (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Irish Sea
• Coordinates
  • Lat. (^o): 54.085
  • Long. (^o): -4.77

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024700	Metagenome / Metatranscriptome	204	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186409_1138011	F024700	N/A	AMASPSTAGVRAPSAHGRRQGIYAGMDLTSVVSTLESHWVVLEAELAEIQKDYAAMRAFTRKYGEYWNRSLTTLKKMRMEKENQLKEIKFQMELFNLHIQQGRDLCYKLSQVASTIKTQPHQLAPQLSVEVVSPILANAQNPLAVPQRPSG