Scaffold Ga0186550_108961

Overview

Basic Information

• Taxon OID: 3300017149
• Scaffold ID: Ga0186550_108961
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater w/o silicate, 18 C, 20 psu salinity and 134 ?mol photons light - Emiliania huxleyi 379 (MMETSP0997)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 978
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): 50.1669
  • Long. (^o): -4.2504

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050084	Metagenome / Metatranscriptome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186550_1089611	F050084	N/A	VSPGCYKILAEDDDWITGVLTMAVGEKDLLHHHKDHLIYVLEGDGVTIYPGGDESAAMVVPLQVGAGIPAPMSAPPFAKHTLLNSGTVPLKMVFFEAKK