Scaffold Ga0186411_111816

Overview

Basic Information

• Taxon OID: 3300017145
• Scaffold ID: Ga0186411_111816
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Irish Sea in f/2 medium with seawater w/o silicate, in 29.4 psu salinity and 687 ?mol photons light - Isochrysis galbana CCMP 1323 (MMETSP0595)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1081
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Irish Sea
• Coordinates
  • Lat. (^o): 54.085
  • Long. (^o): 4.77

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098706	Metagenome / Metatranscriptome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0186411_1118162	F098706	GGA	VSIGDFKTLVKAKYDYNANRDFLKEVSISGDLIEAGNADDVGVGYELTRDFSNRNTNVRLTATSRGYSLSAEYDPNEQLREVGVSREVEVGDYKVDVQPTWLVKAKAARVKLISALNNGKDRVSAQFDYDVDGQQAKDVELGFERTLEEGKVLSASFRPDKSDLEVSLEDSTFESGATWTATANVALDSDPSNLLDAARVTLKRSWGW