NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017145

3300017145: Metatranscriptome of marine eukaryotic communities from Irish Sea in f/2 medium with seawater w/o silicate, in 29.4 psu salinity and 687 ?mol photons light - Isochrysis galbana CCMP 1323 (MMETSP0595)



Overview

Basic Information
IMG/M Taxon OID3300017145 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212123 | Ga0186411
Sample NameMetatranscriptome of marine eukaryotic communities from Irish Sea in f/2 medium with seawater w/o silicate, in 29.4 psu salinity and 687 ?mol photons light - Isochrysis galbana CCMP 1323 (MMETSP0595)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size32397230
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationIrish Sea
CoordinatesLat. (o)54.085Long. (o)4.77Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F098706Metagenome / Metatranscriptome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186411_110472All Organisms → cellular organisms → Eukaryota1219Open in IMG/M
Ga0186411_111816All Organisms → cellular organisms → Eukaryota1081Open in IMG/M
Ga0186411_113431All Organisms → cellular organisms → Eukaryota920Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186411_110472Ga0186411_1104721F098706MVIISPLLCYQSVSIGDFKTLVKAKYDYNANRDFLKEVSISGDLIEAGNADDVGVGYELTRDFSNRNTNVRLTATSRGYSLSAEYDPNEQLREVGVSREVEVGDYKVDVQPTWLVKAKAARVKLISALNNGKDRVSAQFDYDVDGQQAKDVELGFERTLEEGKVLSASFRPDKSDLEVSLEDSTFESGATWTATANVALDSDPSNLLDAARVTLKRSWGW
Ga0186411_111816Ga0186411_1118162F098706VSIGDFKTLVKAKYDYNANRDFLKEVSISGDLIEAGNADDVGVGYELTRDFSNRNTNVRLTATSRGYSLSAEYDPNEQLREVGVSREVEVGDYKVDVQPTWLVKAKAARVKLISALNNGKDRVSAQFDYDVDGQQAKDVELGFERTLEEGKVLSASFRPDKSDLEVSLEDSTFESGATWTATANVALDSDPSNLLDAARVTLKRSWGW
Ga0186411_113431Ga0186411_1134311F098706CPLYQSVPSRSLAMLSVSFFALAANRAEVSTGNLRGENKFDNLKATWDKSVSIGDFKTLVKAKYDYNANRDFLKEVSISGDLIEAGNADDVGVGYELTRDFSNRNTNVRLTATSRGYSLSAEYDPNEQLREVGVSREVEVGDYKVDVQPTWLVKAKAARVKLISALNNGKDRVSAQFDYDVDGQQAKDVELGFERTLEEGKVLSASFRPDKSDLEVSLEDSTFESGATWTATANVALDSDPSNLLDAARVTLKRSWGW

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.