Scaffold Ga0186478_116494

Overview

Basic Information

• Taxon OID: 3300017137
• Scaffold ID: Ga0186478_116494
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Baltic Sea in modified f/2 medium with seawater, 10nmol/L H2SeO3, no copper and silicate, 4 C, 15 psu salinity and 708 ?mol photons light - Skeletonema marinoi SM1012Hels-07 (MMETSP0319)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 608
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Prymnesium → Prymnesium polylepis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Baltic Sea
• Coordinates
  • Lat. (^o): 59.51
  • Long. (^o): 23.15
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017834	Metatranscriptome	238	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186478_1164941	F017834	N/A	IMGKGRGIQTFDLTSNLTKKEGRTIRKTECMIQYHLARMPMYGAHESPQFMKANEMKENIKNIEAKAKQRWELGHV