Basic Information | |
---|---|
Taxon OID | 3300017137 Open in IMG/M |
Scaffold ID | Ga0186478_110242 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Baltic Sea in modified f/2 medium with seawater, 10nmol/L H2SeO3, no copper and silicate, 4 C, 15 psu salinity and 708 ?mol photons light - Skeletonema marinoi SM1012Hels-07 (MMETSP0319) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1237 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Baltic Sea | |||||||
Coordinates | Lat. (o) | 59.51 | Long. (o) | 23.15 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F034938 | Metagenome / Metatranscriptome | 173 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186478_1102421 | F034938 | N/A | PQRHGGRCYLLHPRDIPLPFPFHNPKVTETATMMNAPFPNAQRMHYEGAASSSTGHRTMINEAIILPKISADDQVAQRDVEEESNANATNMVLWRGNLVAEKEAMALRHVFDDMQDHFGHQRADPRVRFNANLVRPSRDGMWFGDLDFTYNINGEHCNLGYIGMDVSVDLCPKLVHKHGQLRLKNYGKSWVYVYLPQLTLDKFKSYVKTGTGWDVSNEGTVYDPNRNLVAIEAMLHHQTGQPKPSFWAVKDKDAPGDNMSFSRIGTVQEVNEHPHQQRVHRGVGIFSVSMEVEGSPNFKPTPRAGDEANLCFTLVSVRTWGVTDCVAPIVHAPNKWY |
⦗Top⦘ |