Scaffold Ga0186359_109816

Overview

Basic Information

• Taxon OID: 3300017125
• Scaffold ID: Ga0186359_109816
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from North Pacific Ocean in K/2 Ian medium, 22 C, 35 psu salinity and 213 ?mol photons light - unclassified eukaryote RCC 2339 (MMETSP1310)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1013
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: North Pacific Ocean
• Coordinates
  • Lat. (^o): 34.35
  • Long. (^o): 130.0833333
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078765	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186359_1098161	F078765	N/A	NAELHAARAGCVGYEIGGAQYQAGLIRGFDPSAILALGLPCNMAAHSLQRSQYVNGLAELPPDVRSALFDTTAQLVRAHYGREAGDAVPWHPYNFHAGNYWNPETGYSPQDETTAELLRAGCHPIPNWIFSPHFPLAALREWTGRQVELFAREGQTLHCLRIKNPGQGVAWTATAVWEHVSTMLAVFRERGLPTPIVYIHNHDFAGTGGATGAELFRLAHGAGYRYLVVDAAYRKNGTHNDNTVLLSALGLSADERLALGRYNRHQQAIEGLLCRFGSRGSHMTPWDSDWAGGTEGSDIRIAKEYHLDVGKINAAKEVASEVFPLERAVTPFSEYKL