NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017125

3300017125: Metatranscriptome of marine eukaryotic communities from North Pacific Ocean in K/2 Ian medium, 22 C, 35 psu salinity and 213 ?mol photons light - unclassified eukaryote RCC 2339 (MMETSP1310)



Overview

Basic Information
IMG/M Taxon OID3300017125 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212071 | Ga0186359
Sample NameMetatranscriptome of marine eukaryotic communities from North Pacific Ocean in K/2 Ian medium, 22 C, 35 psu salinity and 213 ?mol photons light - unclassified eukaryote RCC 2339 (MMETSP1310)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size27823655
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationNorth Pacific Ocean
CoordinatesLat. (o)34.35Long. (o)130.0833333Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040999Metagenome / Metatranscriptome160Y
F078765Metagenome / Metatranscriptome116Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186359_103436All Organisms → cellular organisms → Eukaryota → Sar1932Open in IMG/M
Ga0186359_109816Not Available1013Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186359_103436Ga0186359_1034362F040999MATPSVRILEHRVKFFDDRPEEVNDCRTDDNLKKWLKGKGAAAVVVQGTSQQESITFKVEGAPVKGLTRTNKTSKFYVTVSTESIVMGDFEVGEHTHTFDKQDIEVLAAARANWSLVTTFHDADGKEFAKRESSFKIVAPKA
Ga0186359_109816Ga0186359_1098161F078765NAELHAARAGCVGYEIGGAQYQAGLIRGFDPSAILALGLPCNMAAHSLQRSQYVNGLAELPPDVRSALFDTTAQLVRAHYGREAGDAVPWHPYNFHAGNYWNPETGYSPQDETTAELLRAGCHPIPNWIFSPHFPLAALREWTGRQVELFAREGQTLHCLRIKNPGQGVAWTATAVWEHVSTMLAVFRERGLPTPIVYIHNHDFAGTGGATGAELFRLAHGAGYRYLVVDAAYRKNGTHNDNTVLLSALGLSADERLALGRYNRHQQAIEGLLCRFGSRGSHMTPWDSDWAGGTEGSDIRIAKEYHLDVGKINAAKEVASEVFPLERAVTPFSEYKL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.