Scaffold Ga0186301_108833

Overview

Basic Information

• Taxon OID: 3300017098
• Scaffold ID: Ga0186301_108833
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in f/2 medium, 13 C, 21 psu salinity and 99 ?mol photons light - Pseudo-nitzschia pungens cf. pungens (MMETSP1061)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1328
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Pseudo-nitzschia (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 47.6901
  • Long. (^o): -122.40041

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023270	Metagenome / Metatranscriptome	210	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186301_1088332	F023270	N/A	MISMPTSPSASSWKSSAMAIFGMLQLLLATSAGFVQARNAHFTMEFIPTFKNGLPHKCRPEEVKIMEKFLGDILAEETGMVEHSVQYLDNMYDPAEHHNSEASAASFHLKRHHFSKVRGFDFTFDCPTQNDHYACPDKDWCHVLCLDESVKPGHESLTQQASKLKEKLHRHSKTLEGPYNVKCLGHTAELDFHLLVSVSP