Basic Information | |
---|---|
Taxon OID | 3300017081 Open in IMG/M |
Scaffold ID | Ga0186274_109453 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Pacific Ocean in L1 medium with seawater, 20 C, 33 psu salinity and 488 ?mol photons light - Imantonia sp. RCC918 (MMETSP1474) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 943 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pacific Ocean | |||||||
Coordinates | Lat. (o) | -31.35 | Long. (o) | -78.1 | Alt. (m) | Depth (m) | 10 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F057823 | Metatranscriptome | 135 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186274_1094531 | F057823 | N/A | CPCSRGEFKGRRVRMEAASRTGSSKGVYKRNGEIMAVPHKVGEASWAANEKSAARGGLSSTTKESFKDPNLKASLTPYHPNAMRSRLPVHFKGEAKPFRRFCQQRNQHTYDFFDKGATGAGFVRFRTTSQNYYEYDTKALAVGESNQGIVSEKSKWIHQKQTM |
⦗Top⦘ |