Scaffold Ga0186648_113662

Overview

Basic Information

• Taxon OID: 3300017059
• Scaffold ID: Ga0186648_113662
• Source Dataset Name: Metatranscriptome of freshwater eukaryotic communities from Lake Texoma, Oklahoma in f/2 medium with seawater, 18 C, 18 psu salinity and 201 ?mol photons light - Prymnesium parvum Texoma1 (MMETSP0006_2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 834
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: USA: Lake Texoma, Oklahoma
• Coordinates
  • Lat. (^o): 33.98
  • Long. (^o): -96.67

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008291	Metagenome / Metatranscriptome	335	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186648_1136622	F008291	N/A	PFLGMDIADLRATRIASDSLRNDVRNLQRVVASAPAAANVEPESKVWAFAGHQGRRVLVDKRAPQKPRMDNVTYTASSWKVGLRSTDVHPVTGQHSYDTGNLYRTVHWKEQGFGLNGRFTDALANAGMWRHDGLNTSKTRSKAVPDPAQWGTPKESLTFGM