Basic Information | |
---|---|
Taxon OID | 3300017037 Open in IMG/M |
Scaffold ID | Ga0186650_113375 Open in IMG/M |
Source Dataset Name | Metatranscriptome of freshwater eukaryotic communities from Lake Texoma, Oklahoma in f/2 medium with seawater, 18 C, 18 psu salinity and 199 ?mol photons light - Prymnesium parvum Texoma1 (MMETSP1083) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 848 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Lake Texoma, Oklahoma | |||||||
Coordinates | Lat. (o) | 33.98 | Long. (o) | -96.67 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F057823 | Metatranscriptome | 135 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186650_1133751 | F057823 | N/A | RSRPFLFSPMATQQFVSRTGSSRGVYKRNGEIMAVPHPSAEASWAQNEKTAAHGITASTMKDSFKDPNLKAALTPYHPNAQRSRLPVSFKNEAKPYKRFCQVRNQQTYDFFDKGASGAGFVRFRTTSQNYYDYDTKALSVGESNQGIVSEKSKWIHQKQTM |
⦗Top⦘ |