NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186526_116156

Scaffold Ga0186526_116156


Overview

Basic Information
Taxon OID3300017019 Open in IMG/M
Scaffold IDGa0186526_116156 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium, 6 C, 21 psu salinity and 416 ?mol photons light - Detonula confervacea CCMP 353 (MMETSP1058)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)734
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NameAtlantic Ocean
CoordinatesLat. (o)41.6Long. (o)-71.4Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F099352Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0186526_1161561F099352N/AMVFNGSEAFRGAGAPSLKGEVSVSQNTNRVVLDSQELNAASGAFNLCCAEAYSRFTELKRVKIHPGNMTTERDAVESCSANVFNGIQSSCLEQFEAVKSCISDNSDEWAKCAAVRRELEVCSVTNKFGELKKA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.