Scaffold Ga0186593_104154

Overview

Basic Information

• Taxon OID: 3300017014
• Scaffold ID: Ga0186593_104154
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Arabian Sea in L1 medium, 20 C, 32 psu salinity and 531 ?mol photons light - unclassified eukaryote CCMP 2000 (MMETSP1178)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 929
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Arabian Sea
• Coordinates
  • Lat. (^o): 14.449
  • Long. (^o): 64.9997

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015559	Metagenome / Metatranscriptome	253	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186593_1041541	F015559	N/A	SRCPLRRFEHGARTFVMSHKWGTSTKVGDAFPNVAVDIGFAGLDPNNRKMSGDLNKGQKTLWVSLPGAFTPT