Basic Information | |
---|---|
Taxon OID | 3300017013 Open in IMG/M |
Scaffold ID | Ga0186345_114663 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from North Sea in modified f/2 medium with seawater, 10nmol/L H2SeO3, no copper and silicate, 25 C, 15 psu salinity and 602 ?mol photons light - Skeletonema marinoi SM1012Den-03 (MMETSP0320) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 814 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Fragilariopsis → Fragilariopsis cylindrus → Fragilariopsis cylindrus CCMP1102 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Sea | |||||||
Coordinates | Lat. (o) | 55.5837 | Long. (o) | 12.412 | Alt. (m) | Depth (m) | 20 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F068121 | Metagenome / Metatranscriptome | 125 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186345_1146631 | F068121 | GAG | MSDEQIKQETGLSREDHENRNQFNELPKGKIKPSPEDKTIWTDDDGRPWKLNAEPNAAYHQPYTVPIAFIRAHLSKFIPGLKVPNLKFISPNADGKYSEIVANRYTGELIIEQNIMGTFNLATDAPDAMIDGKLPTIGGHNLLDVIPHNKYGGGYKHIATGIETGSIEKGPIVLAHLEEIASF |
⦗Top⦘ |