Scaffold Ga0186345_110596

Overview

Basic Information

• Taxon OID: 3300017013
• Scaffold ID: Ga0186345_110596
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from North Sea in modified f/2 medium with seawater, 10nmol/L H2SeO3, no copper and silicate, 25 C, 15 psu salinity and 602 ?mol photons light - Skeletonema marinoi SM1012Den-03 (MMETSP0320)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1225
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: North Sea
• Coordinates
  • Lat. (^o): 55.5837
  • Long. (^o): 12.412
  • Depth (m): 20

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034938	Metagenome / Metatranscriptome	173	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186345_1105961	F034938	N/A	MNAPFPNAQRMHYEGAASSSTGGGGHRTMINEAIILPKISADDQVAQRDDEESNANATNMVLWRGNLVAEKEAMALRHVFDDMQDHFGHQRADPRVRFNANLVRPSRDGMWFGDLDFTYNINGEHCNLGYIGMDVCVDLCPKLVHKHGQLRLKNYGKSWVYVYLPQLTLDKFKSYVKTGTGWDVSNEGTVYDPNRNLVAIEAMLHHQTGQPKPSFWAVKDKDAPGDNMSFSRIGTVQEVNEHPHQQRVHRGVGIFSVSMEVEGSPNFKPTPRAGDEANLCFTLVSVRTWGVTDCVAPIVHAPNKWY