Scaffold Ga0186589_111109

Overview

Basic Information

• Taxon OID: 3300017010
• Scaffold ID: Ga0186589_111109
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Arctic Ocean in K/2 medium with silica, 4 C, 35 psu salinity and 107 ?mol photons light - Chaetoceros cf. neogracile RCC 1993 (MMETSP1336)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 789
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Arctic Ocean
• Coordinates
  • Lat. (^o): 70.68333333
  • Long. (^o): -138.3666667
  • Depth (m): 65

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078213	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186589_1111091	F078213	N/A	MGDTLKLEKGFKTMWNPPAVENMMGRNDENSLKGLGEAFKGAVDNIGFKQLAPQEIQDTLRQGGTFVFKGDRLLLEHYDAKVGDNCMIEDILKVL