NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186283_107189

Scaffold Ga0186283_107189


Overview

Basic Information
Taxon OID3300016996 Open in IMG/M
Scaffold IDGa0186283_107189 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic communities from Pacific Ocean in K medium, 20 C, 35 psu salinity and 94 ?mol photons light - Pelagomonas calceolata RCC 969 (MMETSP1328)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)990
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Pelagophyceae → Pelagomonadales → Pelagomonas → Pelagomonas calceolata(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-29.23333333Long. (o)-101.4833333Alt. (m)Depth (m)160
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025972Metagenome / Metatranscriptome199N

Sequences

Protein IDFamilyRBSSequence
Ga0186283_1071891F025972N/AKTSEFWLRAKGCPTAPINPTTPSAARHEATHPTKPPRRAEKAAMWKLLLLATATAVELKQKMIIRNTGSEDLAVYFMGALHEGDLSLWDGSETLNDIVSPGQTTARYVRYNDSFAVRSGDLKWRVRLSLYKNDDAEQPYKVTFHNVMTDEKDQPVELKHHAAGYLWIEPNHHVTHSAAQGHEFALRDRESKERLAVSVHALGRDEL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.