Basic Information | |
---|---|
Taxon OID | 3300016986 Open in IMG/M |
Scaffold ID | Ga0186294_101844 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Pacific Ocean in GSe medium with ammonium, 22 C, 32 psu salinity and 413 ?mol photons light - Pelagomonas calceolata CCMP 1756 (MMETSP0887) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2256 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Pelagophyceae → Pelagomonadales → Pelagomonas → Pelagomonas calceolata | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pacific Ocean | |||||||
Coordinates | Lat. (o) | 30.8333 | Long. (o) | -136.8333 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F082805 | Metagenome / Metatranscriptome | 113 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186294_1018442 | F082805 | GAG | MGHVLEAENSFAVRRRTRPQGGRAGLILSIPADEVSLGSPRVGTIHVQAPTPQAPPLQAFLVDFSQQPMSTFSKRAGPLSVDLHA |
⦗Top⦘ |