Scaffold Ga0186294_101844

Overview

Basic Information

• Taxon OID: 3300016986
• Scaffold ID: Ga0186294_101844
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in GSe medium with ammonium, 22 C, 32 psu salinity and 413 ?mol photons light - Pelagomonas calceolata CCMP 1756 (MMETSP0887)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2256
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Pelagophyceae → Pelagomonadales → Pelagomonas → Pelagomonas calceolata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 30.8333
  • Long. (^o): -136.8333
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082805	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186294_1018442	F082805	GAG	MGHVLEAENSFAVRRRTRPQGGRAGLILSIPADEVSLGSPRVGTIHVQAPTPQAPPLQAFLVDFSQQPMSTFSKRAGPLSVDLHA