Scaffold Ga0186596_113732

Overview

Basic Information

• Taxon OID: 3300016969
• Scaffold ID: Ga0186596_113732
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Antarctica in marine media K with soil extract, 1 C, 36 psu salinity and 392 ?mol photons light - Mantoniella antarctica SL-175 (MMETSP1106)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 741
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Mantoniella → Mantoniella antarctica (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Antarctica
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091101	Metagenome / Metatranscriptome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186596_1137321	F091101	GAGG	MMDTVDLAFDIRLTGLRSATHLNGREGVIRGGDPADSERWTARLDDGTCVSVKSANFVHVRRGDYRRVSP