NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016969

3300016969: Metatranscriptome of marine eukaryotic communities from Antarctica in marine media K with soil extract, 1 C, 36 psu salinity and 392 ?mol photons light - Mantoniella antarctica SL-175 (MMETSP1106)



Overview

Basic Information
IMG/M Taxon OID3300016969 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212308 | Ga0186596
Sample NameMetatranscriptome of marine eukaryotic communities from Antarctica in marine media K with soil extract, 1 C, 36 psu salinity and 392 ?mol photons light - Mantoniella antarctica SL-175 (MMETSP1106)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size30439764
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Mantoniella → Mantoniella antarctica2
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationAntarctica
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029609Metagenome / Metatranscriptome187Y
F091101Metagenome / Metatranscriptome107Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186596_109721All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Mantoniella → Mantoniella antarctica1083Open in IMG/M
Ga0186596_110518Not Available1005Open in IMG/M
Ga0186596_113732All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Mantoniella → Mantoniella antarctica741Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186596_109721Ga0186596_1097212F029609MKLDDFNHELPSASDAGLHVWVEVVGDDGDVDGQLMTVDDWYWR
Ga0186596_110518Ga0186596_1105181F029609LRCHNTAQRWMKLDDFNHEFLRTPDAGLHVCVEVVGDDGDVDGQLMTVDDWYWR
Ga0186596_113732Ga0186596_1137321F091101MMDTVDLAFDIRLTGLRSATHLNGREGVIRGGDPADSERWTARLDDGTCVSVKSANFVHVRRGDYRRVSP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.