Scaffold Ga0186663_113636

Overview

Basic Information

• Taxon OID: 3300016896
• Scaffold ID: Ga0186663_113636
• Source Dataset Name: Metatranscriptome of coastal eukaryotic communities from Pacific Ocean in F/2 medium with seawater, 4nM Fe, 12.5um EDTA, 0.4uM Phosphate, 20 C, 35 psu salinity and 398 ?mol photons light - Thalassiosira rotula GSO102 (MMETSP0912)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 564
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae → Rhizochromulinales → Rhizochromulina → Rhizochromulina marina (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 48.629353
  • Long. (^o): -122.957542
  • Depth (m): .5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067805	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186663_1136361	F067805	N/A	MGRKQQPKEEELTLSKKEQKKVDKLSAQIPYHQGRGNMEEVTKIKGQIDSIWEKAKEAQF