Scaffold Ga0186154_104511

Overview

Basic Information

• Taxon OID: 3300016892
• Scaffold ID: Ga0186154_104511
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from unknown location in f/2 medium with seawater, no silica, at 16 C, 34 psu salinity and 253 ?mol photons light - Isochrysis sp. CCMP 1324 (MMETSP1129)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1839
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013862	Metagenome / Metatranscriptome	267	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186154_1045111	F013862	N/A	MLSLDVWLMLVPKALLFTYTQFFMNYIPQLLNVSYGFDHGQAATLGGVAQGGSVVGLLVVGNMVYKSLSQGGKVRLVGLLLVVCTLVPFALSLGPSVLPRLMVVPLTVLWGLAYALPFYIPPGEFAMQIGGKSATGLFSNLFDAAGFGVSAIWNPWASALAKDGDFRVVLLSQALFGAISLVGMPLCMYRVGAKVEAEKKRN