NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016892

3300016892: Metatranscriptome of marine eukaryotic communities from unknown location in f/2 medium with seawater, no silica, at 16 C, 34 psu salinity and 253 ?mol photons light - Isochrysis sp. CCMP 1324 (MMETSP1129)



Overview

Basic Information
IMG/M Taxon OID3300016892 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0211866 | Ga0186154
Sample NameMetatranscriptome of marine eukaryotic communities from unknown location in f/2 medium with seawater, no silica, at 16 C, 34 psu salinity and 253 ?mol photons light - Isochrysis sp. CCMP 1324 (MMETSP1129)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size26023053
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales1
All Organisms → cellular organisms → Eukaryota1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
Location
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013862Metagenome / Metatranscriptome267Y
F098706Metagenome / Metatranscriptome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186154_104511All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales1839Open in IMG/M
Ga0186154_110821All Organisms → cellular organisms → Eukaryota922Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186154_104511Ga0186154_1045111F013862MLSLDVWLMLVPKALLFTYTQFFMNYIPQLLNVSYGFDHGQAATLGGVAQGGSVVGLLVVGNMVYKSLSQGGKVRLVGLLLVVCTLVPFALSLGPSVLPRLMVVPLTVLWGLAYALPFYIPPGEFAMQIGGKSATGLFSNLFDAAGFGVSAIWNPWASALAKDGDFRVVLLSQALFGAISLVGMPLCMYRVGAKVEAEKKRN
Ga0186154_110821Ga0186154_1108211F098706SRPLYQSVPSRSLAMLSVSFFALAANRAEVSTGNLRGENKFDNLKATWDKSVSIGDFKTLVKAKYDYNANRDFLKEVSISGDLIEAGNADDVGVGYELTRDFSNRNTNVRLTATSRGYSLSAEYDPNEQLREVGVSREVEVGDYKVDVQPTWLVKAKAARVKLISALNNGKDRVSAQFDYDVDGQQAKDVELGFERTLEEGKVLSASFRPDKSDLEVSLEDSTFESGATWTATANVALDSDPSNLLDAARVTLKRSWGW

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.