Scaffold Ga0186381_100107

Overview

Basic Information

• Taxon OID: 3300016891
• Scaffold ID: Ga0186381_100107
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Mediterranean Sea in L1 medium with natural Eastern Pacific seawater, no silica (Eastern Pacific), 21 C, 35 psu salinity and 427 ?mol photons light - Micromonas pusilla CCMP 1723 (MMETSP1403)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 7159
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas pusilla (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Mediterranean Sea
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062730	Metagenome / Metatranscriptome	130	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0186381_1001075	F062730	GAG	MCDTYNMGNETPVGYRLVRVGVRGRVPTLHKRASEDLTTRQKYDLRYREKHRAKLLAYHREYYRKKRTQ