3300016891: Metatranscriptome of marine eukaryotic communities from Mediterranean Sea in L1 medium with natural Eastern Pacific seawater, no silica (Eastern Pacific), 21 C, 35 psu salinity and 427 ?mol photons light - Micromonas pusilla CCMP 1723 (MMETSP1403)

Overview

Basic Information

• IMG/M Taxon OID: 3300016891
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128947 | Gp0212093 | Ga0186381
• Sample Name: Metatranscriptome of marine eukaryotic communities from Mediterranean Sea in L1 medium with natural Eastern Pacific seawater, no silica (Eastern Pacific), 21 C, 35 psu salinity and 427 ?mol photons light - Micromonas pusilla CCMP 1723 (MMETSP1403)
• Sequencing Status: Permanent Draft
• Sequencing Center: National Center for Genome Resources
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 20012057
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas pusilla	1
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Mediterranean Sea
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062730	Metagenome / Metatranscriptome	130	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0186381_100107	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas pusilla	7159
Ga0186381_100157	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	6397
Ga0186381_100486	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	4714

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0186381_100107	Ga0186381_1001075	F062730	MCDTYNMGNETPVGYRLVRVGVRGRVPTLHKRASEDLTTRQKYDLRYREKHRAKLLAYHREYYRKKRTQ
Ga0186381_100157	Ga0186381_1001572	F062730	MGNETPVGYRLVRVGVRGRVPTLHKRASEDLTTRQKYDLRYREKHRAKLLAYHREYYRKKRTQ
Ga0186381_100486	Ga0186381_1004862	F062730	MGNETPVGYRLVRVGVRGRVPTLHKRASEDLTTRQKYDLRYREKHRAKLLAYHREYYRRKCSRSDRQ