Scaffold Ga0186504_104869

Overview

Basic Information

• Taxon OID: 3300016858
• Scaffold ID: Ga0186504_104869
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in modified f/2 media, 18 C, 32 psu salinity and 664 ?mol photons light - Vaucheria litorea CCMP 2940 (MMETSP0946)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 742
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Flabellinia → Vannellidae → Vannella → Vannella robusta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Depth (m): .1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039594	Metagenome / Metatranscriptome	163	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186504_1048691	F039594	N/A	AEPQSMRWRVVVTEGEGVLVTVRNHRCPLQASWVKEIWCDADYFDRPWMCDIEIPTRAAHPGDNAFFVAVYGKNATYSIAFWRGHENCHDFTGSGRNEGLDFCAGIVPYTTWRYDNYNNVDSQAECLFEELYQHFRVQPCYTGVTPECNATLQQFACYESFHRCDAQGFFTGTCRQSCDAVVYECANWFETVDLEHYNCTSSRYIDGNAHVCTGNPSFANIDPASQAFLGPDPDLLLFKSSPSNASS