| Basic Information | |
|---|---|
| Taxon OID | 3300016858 Open in IMG/M |
| Scaffold ID | Ga0186504_104279 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in modified f/2 media, 18 C, 32 psu salinity and 664 ?mol photons light - Vaucheria litorea CCMP 2940 (MMETSP0946) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 822 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | .1 | Location on Map | ||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007073 | Metagenome / Metatranscriptome | 358 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186504_1042791 | F007073 | N/A | YIALLAFCAAALALDAVGEGATGSPDQVINPVNWHGTWTANNRYGGVMYACPKGDRLYGVYSNAGFFVGRFEGRVVEGTWYEGGRGDRNDWQGSFRIEISADNQEFDGFYYRVTQDGKELRWHESRLGAPYPSNPTHDQCLVPGDEPVLGGFFNNPGQGREPAVYSLCKDEYDQIYGSFGAPDGFIEGWSVDDSTGFHGYRYDSNGRSGAYILRSVSDTVVRGFYWRGRLARQNIETSVPEELHRTSYTAKLDDCERVGPGFLRRLRGPSGDA |
| ⦗Top⦘ |