Scaffold Ga0186614_108069

Overview

Basic Information

• Taxon OID: 3300016844
• Scaffold ID: Ga0186614_108069
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Adriatic Sea in f/2 medium with sea water, 20 C, 36 psu salinity and 704 ?mol photons light - Skeletonema marinoi FE60 (MMETSP1040)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 993
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Adriatic Sea
• Coordinates
  • Lat. (^o): 43.5
  • Long. (^o): 14.5
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034938	Metagenome / Metatranscriptome	173	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186614_1080691	F034938	N/A	QQSRNTLHLHYALETTCLTTSSQHHQTMTSITQSETNYASGHWQKNLVSESMGSEAANVIPNIADQRGYHDEEETMVTWRGNLVAEKEAKALRHVFDDLQDHFGHQRPDPNVRFEANLTHPGHGDVWQADLDFTYNIKGEHCKLAYIGMDMCLDLTPKKIHKYGRPMLNDYGETWVYAYLPDMTMDKIKSYVKAGTGWDVSAAGTVVDPNRNLVAIKAKLNNQAEQPNPSFWVVTEKDSAQDDVSFSRIGSVQDVHSDNSQKRIHRGVGIFSVSMEVEGTPNFKPSSHSGEVANLVFTLVSVRTWGITDCIAPIVHAPMM