NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186646_112641

Scaffold Ga0186646_112641


Overview

Basic Information
Taxon OID3300016838 Open in IMG/M
Scaffold IDGa0186646_112641 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater eukaryotic communities from Lake Texoma, Oklahoma in f/2 medium with seawater, f/200 nitrate, 18 C, 18 psu salinity and 617 ?mol photons light - Prymnesium parvum Texoma1 (MMETSP0814)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)505
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NameUSA: Lake Texoma, Oklahoma
CoordinatesLat. (o)33.98Long. (o)-96.67Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043734Metagenome / Metatranscriptome155Y

Sequences

Protein IDFamilyRBSSequence
Ga0186646_1126411F043734N/AGGAPLPLRQMNSFRAKQLLQPAARWGMTLGVVGFFLMYEDLPQLILQTPYGNFPGWEGVARHYGLLKPKE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.