Scaffold Ga0186646_104151

Overview

Basic Information

• Taxon OID: 3300016838
• Scaffold ID: Ga0186646_104151
• Source Dataset Name: Metatranscriptome of freshwater eukaryotic communities from Lake Texoma, Oklahoma in f/2 medium with seawater, f/200 nitrate, 18 C, 18 psu salinity and 617 ?mol photons light - Prymnesium parvum Texoma1 (MMETSP0814)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1350
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina brevifila (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: USA: Lake Texoma, Oklahoma
• Coordinates
  • Lat. (^o): 33.98
  • Long. (^o): -96.67

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005228	Metagenome / Metatranscriptome	407	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186646_1041511	F005228	GAG	MDQPKQIVAAKYQQTTSRATPDAVARELRKLPAASGPLDSRKRALHDLAHALAYVQEQHKTKVVEACTKDDAAGLLLSLLDDIDAAPPVPASEDVIRVGRRVLGMGPMDARLYVLSCFVNLAYLGGAAMLRLPPSGQRISAMELLMDTLLNTADSESVLFYAVAGLYNLSNDGSFADLAARKPGLLQKLEQLSASPNPDTVKYASGTVEYWRKHAGAWPPH