Basic Information | |
---|---|
Taxon OID | 3300016826 Open in IMG/M |
Scaffold ID | Ga0186699_112287 Open in IMG/M |
Source Dataset Name | Metatranscriptome of coastal eukaryotic communities from Atlantic Ocean in f/2 medium with seawater, 14 C, 36 psu salinity and 153 ?mol photons light - Skeletonema menzellii CCMP 793 (MMETSP0603) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 650 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 41.566 | Long. (o) | -70.5842 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F099352 | Metatranscriptome | 103 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186699_1122871 | F099352 | N/A | MVFNGAEAFKGGASAPSLEREVSVTSNNNRVLLDSQELNAASGAFNLCCGEAYARFSELKRLKVHPGNMTKERDAVESCSADVYNGIKSSCVEQFDAVMSCLSDNPTEWAKCASMRRELEVCSVKNNLGELKKLSS |
⦗Top⦘ |