Scaffold Ga0186699_110091

Overview

Basic Information

• Taxon OID: 3300016826
• Scaffold ID: Ga0186699_110091
• Source Dataset Name: Metatranscriptome of coastal eukaryotic communities from Atlantic Ocean in f/2 medium with seawater, 14 C, 36 psu salinity and 153 ?mol photons light - Skeletonema menzellii CCMP 793 (MMETSP0603)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 921
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): 41.566
  • Long. (^o): -70.5842

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034938	Metagenome / Metatranscriptome	173	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186699_1100911	F034938	N/A	TNSNMNTLVQWRGNVVSEKEAKALRHVVDDLQDHFGHQRPDPRVRFNIVNLAHPGQGHIWHGDVEFTYDIEGDHCNLKYTSMDVCVDLTPKLVHRHGQPMLQNYGKTWVYVYLPQPTIDRIKSYVKAGTGWDVSDEGFIEDPNRNVTAIEAKMNHRSEELPEPSFWAMKDKDASEGEEEIMSFSRIGSVQEVMAQSHQQHVHRGVGIFSVTMEVEGTPNFMPTPGEGDEAKLRFTLVSARTWGFTESVAPIVYAPSKWH