Scaffold Ga0186280_101346

Overview

Basic Information

• Taxon OID: 3300016814
• Scaffold ID: Ga0186280_101346
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in L1 medium with artificial seawater, 25 C, 31 psu salinity and 699 ?mol photons light - Symbiodinium kawagutii CCMP 2468 (MMETSP0134_2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 689
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 21.25
  • Long. (^o): -158.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018723	Metagenome / Metatranscriptome	233	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186280_1013461	F018723	N/A	TSLTGCSLPLGPVMPDKKEASSKKGKEPFTSQYEVKDVFPHFCDRKTKLLALQDVPYVLRAMGLTIYVDEEKGIREQLEKVDGMGKPVSLQTMQSWVEEHGKNYVKSYDDAFSAVGTLLHEGIIGDPSGRVQIPFLRHLVSEVGDKIKLDTFDKIIKGGDSAVAVGIKGDSCSLDEFLTFLQK