| Basic Information | |
|---|---|
| Taxon OID | 3300016744 Open in IMG/M |
| Scaffold ID | Ga0183099_1314876 Open in IMG/M |
| Source Dataset Name | Microbial communities from bioreactor (seeded with anoxic lake sediment) at LBNL, California, USA - Biofuel metagenome 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 601 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Bioreactor → Microbial Communities From Bioreactor (Seeded With Sewage Sludge) At Lbnl, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lawrence Berkeley National Laboratory, California, USA | |||||||
| Coordinates | Lat. (o) | 37.8754404 | Long. (o) | -122.2477251 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016215 | Metagenome / Metatranscriptome | 249 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0183099_13148761 | F016215 | AGG | MINRRNAVMGWAVWKVAKRVGRKKARGAAPSVEGGKPNKSLIAVVVAALAGASAFLRGRRSASD |
| ⦗Top⦘ |