Scaffold Ga0182128_1054977

Overview

Basic Information

• Taxon OID: 3300015277
• Scaffold ID: Ga0182128_1054977
• Source Dataset Name: Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 561
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Source Dataset Sampling Location

• Location Name: USA: Michigan
• Coordinates
  • Lat. (^o): 42.39
  • Long. (^o): -85.37

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033684	Metagenome	176	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0182128_10549772	F033684	GGAGG	MEALQGWDAQEDSPTVVHLTTCLLTLDEQYDRQASELRKCLRRAKEAEIFSRML*