Basic Information | |
---|---|
Family ID | F033684 |
Family Type | Metagenome |
Number of Sequences | 176 |
Average Sequence Length | 55 residues |
Representative Sequence | MEALQGRDAQEDSPTVVHLTTYLLALDEQYDRQASELRKCLRRAEEAEIFSRML |
Number of Associated Samples | 70 |
Number of Associated Scaffolds | 176 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 67.05 % |
% of genes near scaffold ends (potentially truncated) | 42.05 % |
% of genes from short scaffolds (< 2000 bps) | 98.30 % |
Associated GOLD sequencing projects | 70 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.57 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (63.068 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (96.023 % of family members) |
Environment Ontology (ENVO) | Unclassified (96.591 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (96.591 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.78% β-sheet: 0.00% Coil/Unstructured: 51.22% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 63.07 % |
All Organisms | root | All Organisms | 36.93 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300009148|Ga0105243_11214399 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 768 | Open in IMG/M |
3300013296|Ga0157374_12518153 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 542 | Open in IMG/M |
3300013297|Ga0157378_10764141 | Not Available | 990 | Open in IMG/M |
3300013297|Ga0157378_11256836 | Not Available | 781 | Open in IMG/M |
3300013297|Ga0157378_11646237 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 688 | Open in IMG/M |
3300014745|Ga0157377_11369055 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 556 | Open in IMG/M |
3300015267|Ga0182122_1013247 | Not Available | 796 | Open in IMG/M |
3300015267|Ga0182122_1029334 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 647 | Open in IMG/M |
3300015268|Ga0182154_1005489 | Not Available | 1010 | Open in IMG/M |
3300015268|Ga0182154_1007527 | Not Available | 926 | Open in IMG/M |
3300015268|Ga0182154_1036596 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 613 | Open in IMG/M |
3300015274|Ga0182188_1012770 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 757 | Open in IMG/M |
3300015274|Ga0182188_1022185 | Not Available | 658 | Open in IMG/M |
3300015274|Ga0182188_1045326 | Not Available | 549 | Open in IMG/M |
3300015275|Ga0182172_1073466 | Not Available | 509 | Open in IMG/M |
3300015276|Ga0182170_1061415 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 539 | Open in IMG/M |
3300015276|Ga0182170_1074598 | Not Available | 508 | Open in IMG/M |
3300015277|Ga0182128_1004277 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 1122 | Open in IMG/M |
3300015277|Ga0182128_1054977 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 561 | Open in IMG/M |
3300015277|Ga0182128_1068324 | Not Available | 526 | Open in IMG/M |
3300015279|Ga0182174_1004650 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 1132 | Open in IMG/M |
3300015279|Ga0182174_1026196 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 708 | Open in IMG/M |
3300015281|Ga0182160_1057348 | Not Available | 563 | Open in IMG/M |
3300015281|Ga0182160_1066166 | Not Available | 540 | Open in IMG/M |
3300015286|Ga0182176_1037677 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 651 | Open in IMG/M |
3300015286|Ga0182176_1084279 | Not Available | 504 | Open in IMG/M |
3300015287|Ga0182171_1005856 | Not Available | 1064 | Open in IMG/M |
3300015287|Ga0182171_1079896 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 519 | Open in IMG/M |
3300015288|Ga0182173_1029591 | Not Available | 684 | Open in IMG/M |
3300015288|Ga0182173_1063102 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 553 | Open in IMG/M |
3300015288|Ga0182173_1063135 | Not Available | 553 | Open in IMG/M |
3300015289|Ga0182138_1085447 | Not Available | 509 | Open in IMG/M |
3300015291|Ga0182125_1014789 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 853 | Open in IMG/M |
3300015292|Ga0182141_1028447 | Not Available | 713 | Open in IMG/M |
3300015294|Ga0182126_1095616 | Not Available | 503 | Open in IMG/M |
3300015295|Ga0182175_1058558 | Not Available | 590 | Open in IMG/M |
3300015295|Ga0182175_1065351 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 571 | Open in IMG/M |
3300015296|Ga0182157_1091161 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 523 | Open in IMG/M |
3300015296|Ga0182157_1093271 | Not Available | 519 | Open in IMG/M |
3300015298|Ga0182106_1077039 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 550 | Open in IMG/M |
3300015299|Ga0182107_1044245 | Not Available | 652 | Open in IMG/M |
3300015299|Ga0182107_1054599 | Not Available | 614 | Open in IMG/M |
3300015299|Ga0182107_1084185 | Not Available | 538 | Open in IMG/M |
3300015300|Ga0182108_1053784 | Not Available | 621 | Open in IMG/M |
3300015302|Ga0182143_1075289 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 557 | Open in IMG/M |
3300015303|Ga0182123_1029826 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 708 | Open in IMG/M |
3300015304|Ga0182112_1028093 | Not Available | 743 | Open in IMG/M |
3300015304|Ga0182112_1094650 | Not Available | 521 | Open in IMG/M |
3300015305|Ga0182158_1008854 | Not Available | 1014 | Open in IMG/M |
3300015305|Ga0182158_1052891 | Not Available | 618 | Open in IMG/M |
3300015305|Ga0182158_1058869 | Not Available | 599 | Open in IMG/M |
3300015305|Ga0182158_1080356 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 545 | Open in IMG/M |
3300015307|Ga0182144_1053467 | Not Available | 624 | Open in IMG/M |
3300015307|Ga0182144_1085780 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 542 | Open in IMG/M |
3300015307|Ga0182144_1086371 | Not Available | 540 | Open in IMG/M |
3300015308|Ga0182142_1083904 | Not Available | 556 | Open in IMG/M |
3300015313|Ga0182164_1134580 | Not Available | 506 | Open in IMG/M |
3300015314|Ga0182140_1046909 | Not Available | 663 | Open in IMG/M |
3300015314|Ga0182140_1064111 | Not Available | 605 | Open in IMG/M |
3300015314|Ga0182140_1073072 | Not Available | 581 | Open in IMG/M |
3300015314|Ga0182140_1075450 | Not Available | 576 | Open in IMG/M |
3300015314|Ga0182140_1083327 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 558 | Open in IMG/M |
3300015314|Ga0182140_1102157 | Not Available | 523 | Open in IMG/M |
3300015314|Ga0182140_1112298 | Not Available | 508 | Open in IMG/M |
3300015321|Ga0182127_1026521 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 805 | Open in IMG/M |
3300015321|Ga0182127_1038829 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 721 | Open in IMG/M |
3300015321|Ga0182127_1090917 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 557 | Open in IMG/M |
3300015321|Ga0182127_1107047 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 528 | Open in IMG/M |
3300015322|Ga0182110_1080994 | Not Available | 577 | Open in IMG/M |
3300015322|Ga0182110_1103223 | Not Available | 534 | Open in IMG/M |
3300015322|Ga0182110_1108542 | Not Available | 525 | Open in IMG/M |
3300015323|Ga0182129_1066054 | Not Available | 597 | Open in IMG/M |
3300015323|Ga0182129_1095818 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 534 | Open in IMG/M |
3300015341|Ga0182187_1076172 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 709 | Open in IMG/M |
3300015341|Ga0182187_1102045 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 641 | Open in IMG/M |
3300015341|Ga0182187_1103398 | Not Available | 638 | Open in IMG/M |
3300015341|Ga0182187_1202000 | Not Available | 500 | Open in IMG/M |
3300015342|Ga0182109_1122476 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 632 | Open in IMG/M |
3300015342|Ga0182109_1145119 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 593 | Open in IMG/M |
3300015342|Ga0182109_1147682 | Not Available | 589 | Open in IMG/M |
3300015342|Ga0182109_1189538 | Not Available | 535 | Open in IMG/M |
3300015342|Ga0182109_1207405 | Not Available | 517 | Open in IMG/M |
3300015342|Ga0182109_1215779 | Not Available | 509 | Open in IMG/M |
3300015343|Ga0182155_1061377 | Not Available | 800 | Open in IMG/M |
3300015343|Ga0182155_1072285 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 756 | Open in IMG/M |
3300015343|Ga0182155_1184890 | Not Available | 541 | Open in IMG/M |
3300015343|Ga0182155_1205864 | Not Available | 519 | Open in IMG/M |
3300015344|Ga0182189_1025547 | Not Available | 1090 | Open in IMG/M |
3300015344|Ga0182189_1058335 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 829 | Open in IMG/M |
3300015344|Ga0182189_1090144 | Not Available | 711 | Open in IMG/M |
3300015344|Ga0182189_1165274 | Not Available | 570 | Open in IMG/M |
3300015345|Ga0182111_1030314 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 1081 | Open in IMG/M |
3300015345|Ga0182111_1222924 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 521 | Open in IMG/M |
3300015345|Ga0182111_1230064 | Not Available | 515 | Open in IMG/M |
3300015346|Ga0182139_1182867 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 564 | Open in IMG/M |
3300015346|Ga0182139_1211575 | Not Available | 533 | Open in IMG/M |
3300015346|Ga0182139_1228280 | Not Available | 517 | Open in IMG/M |
3300015347|Ga0182177_1199849 | Not Available | 548 | Open in IMG/M |
3300015347|Ga0182177_1200871 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 547 | Open in IMG/M |
3300015347|Ga0182177_1208457 | Not Available | 539 | Open in IMG/M |
3300015351|Ga0182161_1033505 | Not Available | 1105 | Open in IMG/M |
3300015351|Ga0182161_1113629 | Not Available | 705 | Open in IMG/M |
3300015351|Ga0182161_1137073 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula | 656 | Open in IMG/M |
3300015351|Ga0182161_1173832 | Not Available | 598 | Open in IMG/M |
3300015355|Ga0182159_1157693 | Not Available | 711 | Open in IMG/M |
3300015355|Ga0182159_1220352 | Not Available | 617 | Open in IMG/M |
3300015355|Ga0182159_1225803 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 610 | Open in IMG/M |
3300015355|Ga0182159_1302602 | Not Available | 536 | Open in IMG/M |
3300015355|Ga0182159_1354126 | Not Available | 500 | Open in IMG/M |
3300015361|Ga0182145_1036702 | Not Available | 869 | Open in IMG/M |
3300017404|Ga0182203_1085193 | Not Available | 623 | Open in IMG/M |
3300017404|Ga0182203_1155708 | Not Available | 511 | Open in IMG/M |
3300017407|Ga0182220_1020380 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 794 | Open in IMG/M |
3300017407|Ga0182220_1037079 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 678 | Open in IMG/M |
3300017407|Ga0182220_1085499 | Not Available | 539 | Open in IMG/M |
3300017409|Ga0182204_1051442 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 649 | Open in IMG/M |
3300017409|Ga0182204_1069652 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 594 | Open in IMG/M |
3300017411|Ga0182208_1071494 | Not Available | 606 | Open in IMG/M |
3300017411|Ga0182208_1090398 | Not Available | 564 | Open in IMG/M |
3300017413|Ga0182222_1022032 | Not Available | 756 | Open in IMG/M |
3300017413|Ga0182222_1088293 | Not Available | 530 | Open in IMG/M |
3300017413|Ga0182222_1106867 | Not Available | 503 | Open in IMG/M |
3300017415|Ga0182202_1037422 | Not Available | 760 | Open in IMG/M |
3300017415|Ga0182202_1038722 | Not Available | 752 | Open in IMG/M |
3300017415|Ga0182202_1070487 | Not Available | 626 | Open in IMG/M |
3300017417|Ga0182230_1041634 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 804 | Open in IMG/M |
3300017420|Ga0182228_1093350 | Not Available | 566 | Open in IMG/M |
3300017420|Ga0182228_1101932 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 548 | Open in IMG/M |
3300017424|Ga0182219_1048941 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 697 | Open in IMG/M |
3300017424|Ga0182219_1051408 | Not Available | 686 | Open in IMG/M |
3300017424|Ga0182219_1097442 | Not Available | 564 | Open in IMG/M |
3300017424|Ga0182219_1132141 | Not Available | 512 | Open in IMG/M |
3300017425|Ga0182224_1090165 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 612 | Open in IMG/M |
3300017425|Ga0182224_1095335 | Not Available | 602 | Open in IMG/M |
3300017425|Ga0182224_1105944 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 582 | Open in IMG/M |
3300017425|Ga0182224_1118911 | Not Available | 561 | Open in IMG/M |
3300017425|Ga0182224_1159530 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 508 | Open in IMG/M |
3300017427|Ga0182190_1124893 | Not Available | 554 | Open in IMG/M |
3300017427|Ga0182190_1146939 | Not Available | 523 | Open in IMG/M |
3300017430|Ga0182192_1085015 | Not Available | 644 | Open in IMG/M |
3300017430|Ga0182192_1159987 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 517 | Open in IMG/M |
3300017433|Ga0182206_1037697 | Not Available | 791 | Open in IMG/M |
3300017433|Ga0182206_1061233 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 682 | Open in IMG/M |
3300017436|Ga0182209_1043627 | Not Available | 779 | Open in IMG/M |
3300017436|Ga0182209_1055794 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 722 | Open in IMG/M |
3300017438|Ga0182191_1061225 | Not Available | 724 | Open in IMG/M |
3300017438|Ga0182191_1113206 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 592 | Open in IMG/M |
3300017438|Ga0182191_1125801 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 571 | Open in IMG/M |
3300017438|Ga0182191_1135455 | Not Available | 557 | Open in IMG/M |
3300017438|Ga0182191_1166019 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 519 | Open in IMG/M |
3300017442|Ga0182221_1082733 | Not Available | 630 | Open in IMG/M |
3300017442|Ga0182221_1169186 | Not Available | 503 | Open in IMG/M |
3300017443|Ga0182193_1029544 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 940 | Open in IMG/M |
3300017443|Ga0182193_1116961 | Not Available | 603 | Open in IMG/M |
3300017443|Ga0182193_1190987 | Not Available | 508 | Open in IMG/M |
3300017443|Ga0182193_1194755 | Not Available | 504 | Open in IMG/M |
3300017680|Ga0182233_1019819 | Not Available | 1205 | Open in IMG/M |
3300017680|Ga0182233_1087762 | Not Available | 568 | Open in IMG/M |
3300017680|Ga0182233_1098871 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 539 | Open in IMG/M |
3300017682|Ga0182229_1077137 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 577 | Open in IMG/M |
3300017683|Ga0182218_1039218 | Not Available | 761 | Open in IMG/M |
3300017683|Ga0182218_1043663 | Not Available | 738 | Open in IMG/M |
3300017683|Ga0182218_1137494 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 520 | Open in IMG/M |
3300017684|Ga0182225_1078424 | Not Available | 608 | Open in IMG/M |
3300017684|Ga0182225_1111674 | Not Available | 545 | Open in IMG/M |
3300017685|Ga0182227_1073362 | Not Available | 635 | Open in IMG/M |
3300017685|Ga0182227_1133622 | Not Available | 506 | Open in IMG/M |
3300017685|Ga0182227_1136052 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 502 | Open in IMG/M |
3300017686|Ga0182205_1028365 | Not Available | 905 | Open in IMG/M |
3300017689|Ga0182231_1069959 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 665 | Open in IMG/M |
3300017690|Ga0182223_1025702 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 772 | Open in IMG/M |
3300017690|Ga0182223_1068271 | Not Available | 594 | Open in IMG/M |
3300017690|Ga0182223_1079228 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 571 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 96.02% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.57% |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 0.57% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017417 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017682 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017689 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0105243_112143991 | 3300009148 | Miscanthus Rhizosphere | LQGRDAQEDSPTVMHLTMYLLALDEQYDRQALELRACLRRVEEAEIFNRML* |
Ga0157374_125181532 | 3300013296 | Miscanthus Rhizosphere | MAALQGRDAQEDSPTKVHLTTYLLALDEKYDRQALELRSCLHRAEEAEIFSRMLQVQLAE |
Ga0157378_107641413 | 3300013297 | Miscanthus Rhizosphere | MEALQGRDVQEDSPTVVHLTTYLLALDEQYDRQTLELGACLRCIGEAKIFNWML* |
Ga0157378_112568362 | 3300013297 | Miscanthus Rhizosphere | MEALQGWDAQEDSPTMVHLTMYLLALDEQYDRRALELRSCLHRAEEAEVFNRML* |
Ga0157378_116462371 | 3300013297 | Miscanthus Rhizosphere | MEALQGQDVQEDSPTVVHLTTYLIALDEQYDRQALELGSCLRRAGEAEIFNRML* |
Ga0157377_113690552 | 3300014745 | Miscanthus Rhizosphere | MEALQGWDAEEDSPTVVHLTTYLLALDEQYDHQALELRACLRCAEEAEVFNRML* |
Ga0182122_10132472 | 3300015267 | Miscanthus Phyllosphere | MEALKGQDAQEDSPTVVHLTTYLLTLDEQYDRQASELRKCLRLAEEAEIFSMMLQV* |
Ga0182122_10293342 | 3300015267 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTVVHLTTYLLALDEQYDRQALELRACLRRAEEAEVFNRML* |
Ga0182154_10054891 | 3300015268 | Miscanthus Phyllosphere | RMEALQGQDAQEDSPTVVHLTTYLLALNEQYDRQALELRIYLRRAKEAEIFNRMLQV* |
Ga0182154_10075271 | 3300015268 | Miscanthus Phyllosphere | MDALLGWDMQEDNLTVVHLTTYLLALDEQYDRQALELRKCLRRAMEDEIFSRMLQV* |
Ga0182154_10365962 | 3300015268 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTLVHLTTYLLTLDEQYDRQALELRIYLRWAEEAKIFNRML* |
Ga0182188_10127703 | 3300015274 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTVVHLTTYLLALDEQYDRQAMELRICLRRAEEAEIFTQIL* |
Ga0182188_10221851 | 3300015274 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTMVHLTTYLLALDEQYDRQASELRMCLHQAKEAEIFSRMLKASRPLVGFR* |
Ga0182188_10453262 | 3300015274 | Miscanthus Phyllosphere | PPLDKNRRAWRARMEALQGCDVQEDSPTMVHLTTYLLALDEQYDRQALELRACLRRAEEAKIFTRML* |
Ga0182172_10734661 | 3300015275 | Miscanthus Phyllosphere | MEALQGRGAQEDSPIVVHLTTYLLALDEQYDRRAEEAEIFNQMLQV |
Ga0182170_10614152 | 3300015276 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTVVHLTTYLLALDEKYDRQASKLRKCLWRAEEAEIFSRML* |
Ga0182170_10745982 | 3300015276 | Miscanthus Phyllosphere | LQGRDVQEDSPTVVHLTTYLLALDEQYDRQALELRACLRRAEEAEIFNRMLQV* |
Ga0182128_10042772 | 3300015277 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTMVHLTTYLLALDEHYDQQALELRKCLRRAEEAEIFSRMLQV* |
Ga0182128_10549772 | 3300015277 | Miscanthus Phyllosphere | MEALQGWDAQEDSPTVVHLTTCLLTLDEQYDRQASELRKCLRRAKEAEIFSRML* |
Ga0182128_10683241 | 3300015277 | Miscanthus Phyllosphere | MEALQGRDVQEDNPTMVHLTTYLLALDEQYDRQALELRACLRRAEEAEIFNRML* |
Ga0182174_10046502 | 3300015279 | Miscanthus Phyllosphere | MEALQGQEAQEDSPTMLHLTMYLLALDEQYDQQALELRKCLRRAEEAKILSRML* |
Ga0182174_10261962 | 3300015279 | Miscanthus Phyllosphere | MEALQGWDAHEDSPTMVHLTTYLLALDEQYDWQALELRSCLHRAEEAEIFNRMLQVQLVRSAC* |
Ga0182160_10573481 | 3300015281 | Miscanthus Phyllosphere | QEDSLTVVYLTTYLFGLDEQYDRQASKLRMCLRQAKEAEIFSRML* |
Ga0182160_10661662 | 3300015281 | Miscanthus Phyllosphere | MEALQGWDAQENSPTMVHLTTYLLALDDQYDWQALELRACLRRAEEAEIFTRML* |
Ga0182176_10376772 | 3300015286 | Miscanthus Phyllosphere | METLQGRDAQEDSPTVVHLTTYLLALDEQYDWQDLELRACLWRAEEAKVFNRML |
Ga0182176_10842791 | 3300015286 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTVVHLTTYLLALDEQYDRQASEMRKCLHRAEEAKIFTWML* |
Ga0182171_10058563 | 3300015287 | Miscanthus Phyllosphere | AWRARMEALQGCDAQEDSQTMVHLTMYLLALDEQYDRQASELRTCLCRAEEVEIFTRML* |
Ga0182171_10798962 | 3300015287 | Miscanthus Phyllosphere | MEAFQGRDMQEDSPTVVHLTMYLLALDEQYDRQALELRACLWRAEEAEIFNWMLQV* |
Ga0182173_10295911 | 3300015288 | Miscanthus Phyllosphere | RMEALQGWDAQEDSPTTVHLTTYLLALDEQYDRQALDLRKCLRRAEEDEIFSRML* |
Ga0182173_10631022 | 3300015288 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTVVHLTTYLLALDEQYDWQASELRKCFWRVEEAKIFSRMLQV* |
Ga0182173_10631352 | 3300015288 | Miscanthus Phyllosphere | MEALQGREAQEDSPTVVHLTTYLLALDVQYDRQALELRICLRRVEEAEIFTQML* |
Ga0182138_10854471 | 3300015289 | Miscanthus Phyllosphere | MEALQGQDAQEDSPTMVHLTMHLLALDEQYDRQALELRKCLQQAEQVKIFSRML* |
Ga0182125_10147891 | 3300015291 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTVVLLTTYLLALDEQYDRQALELRICLRQAEEAEIFTR |
Ga0182141_10284471 | 3300015292 | Miscanthus Phyllosphere | ARMEALQGREVQEDSPTMVHLTTYLLALDEQYDRQALELWICLRWAEEAEIFT* |
Ga0182126_10956161 | 3300015294 | Miscanthus Phyllosphere | QEDSPTVVHLTTYLLALDEQYDRQALELRACLRRTEEAEIFTRMLQV* |
Ga0182175_10585582 | 3300015295 | Miscanthus Phyllosphere | MEALQGRGAQEDSPTVVHLTMYLLALDEQYDRQASKLRKCLRRAKEAKIFSRMLQV* |
Ga0182175_10653511 | 3300015295 | Miscanthus Phyllosphere | MEALQGQDVQEDSPTMVHLTTYLLALDEQYDRQALELRACLRRTEEAEVFNWMLQV* |
Ga0182157_10911612 | 3300015296 | Miscanthus Phyllosphere | MEALQGWDAQEDSPTMVHLTTYLLALNEQYDWQTLKLRKYLRRAEKAEIFSRMLQV* |
Ga0182157_10932712 | 3300015296 | Miscanthus Phyllosphere | MEALQGQDVQEDSPTVVHLTTYLIALDKQYNRQVSELRKCLRRAKEAEIFSRML* |
Ga0182106_10770391 | 3300015298 | Miscanthus Phyllosphere | MEALQGQDAQEDSPTVVHLTTYLLALDEQYDRQALELRICLRRAEEADVFNRIL* |
Ga0182107_10442452 | 3300015299 | Miscanthus Phyllosphere | MEALQGWDAQEDSPTVVYMTMYLLALDEQYDWQALELRACFRRTEEAEIFNRML* |
Ga0182107_10545992 | 3300015299 | Miscanthus Phyllosphere | MEALQGRDAQEDYPIVVHLTTYLLALDEQYDQQALELRACLWCAEEAEIFNWMLQV* |
Ga0182107_10841851 | 3300015299 | Miscanthus Phyllosphere | AQEDSPTVVHLTMYLLALDEQYDRQALEMRKCLHRAEEAKIFTRML* |
Ga0182108_10537842 | 3300015300 | Miscanthus Phyllosphere | MEALQRQDAQEDSPTVVHLTTYLLALDEQYDRQASELRKFLRRAEEAEIFSRML* |
Ga0182143_10752892 | 3300015302 | Miscanthus Phyllosphere | MKALQGRDAQEDSPTVVHLTTYLLALDEQYDHQALELGACLRRAEEAEVFNRMLQV* |
Ga0182123_10298261 | 3300015303 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTVVHLTMYLLALDEQYDRQALELRACLRHAEEAEIFNRML* |
Ga0182112_10280931 | 3300015304 | Miscanthus Phyllosphere | RDRMEALQGWDAQENSPTMVHLTTYLLALDEQYDWQASEMRKCLHQAEEAEIFT* |
Ga0182112_10946502 | 3300015304 | Miscanthus Phyllosphere | MEALQGWDAQEDSPTMVHLTTYLLALDEQFDRQALELSACLWRAKEAEIFTRML |
Ga0182158_10088541 | 3300015305 | Miscanthus Phyllosphere | MEALQGWDTQEDSQTVVHLTMYLLALDEQYGRQASEMRKCLHRAKEAEIFTRML* |
Ga0182158_10528912 | 3300015305 | Miscanthus Phyllosphere | MEALQGQDAQEDSPTVVHLTTYLLALDEQYDRQASELRKCLQRAEEAKIFSRML* |
Ga0182158_10588692 | 3300015305 | Miscanthus Phyllosphere | QDAQEDSPIMVHLTTYLLALDEQYDRQALELRSYLRRAEEAEIFNQMLQV* |
Ga0182158_10803561 | 3300015305 | Miscanthus Phyllosphere | MEALQGWDAHEDSPTVVHLTTYLLALDEQYDRQASELRKCLRQAEEAEIFSRML* |
Ga0182144_10534672 | 3300015307 | Miscanthus Phyllosphere | MEALLGWDAQEDSPTMVHLTTYLLALDEQYDWQALELRKCLWRAEEAEIFSRML* |
Ga0182144_10857802 | 3300015307 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTVVHLTTYLLALDEQYDRQASELRKCLRRAEEAEIFSRML* |
Ga0182144_10863712 | 3300015307 | Miscanthus Phyllosphere | EALQGRDAQEDSPTVVHLTTYLLALDEQYDHQALELGACLWRLGEAEVFNRML* |
Ga0182142_10839041 | 3300015308 | Miscanthus Phyllosphere | MEALQGQDAQEDSSTVVHLTTYLLSLDEQYDRQALELGACLRRAGEAEIFNRML* |
Ga0182164_11345802 | 3300015313 | Switchgrass Phyllosphere | MEALQGRDAQEDSPTVVHLTTYLLALDEQYDRQALELRACLRRTKEAEIFNQML* |
Ga0182140_10314802 | 3300015314 | Miscanthus Phyllosphere | MEALQRQDAQEDSSTMVLLAMYLLALDEQYDHQALEMRSCLHRAEEAKIFNRMLQVQLTEAHASVAAVES* |
Ga0182140_10469092 | 3300015314 | Miscanthus Phyllosphere | MEALQGRDVQEDSPTMVHLTTYLITLDEQYDHQALELGACLQCTEEAEVFNRMLQV* |
Ga0182140_10641112 | 3300015314 | Miscanthus Phyllosphere | MEALQGRDVQEDSPIVVHLTTYLLALDEQYDHQALELRACLRRAEEAEVFNRML* |
Ga0182140_10730722 | 3300015314 | Miscanthus Phyllosphere | DAQEDNPIVVHLTTYLLALDEQYDRQALELRACLRRTEEAEVFNWML* |
Ga0182140_10754501 | 3300015314 | Miscanthus Phyllosphere | MEALQGQDAQEDNPTVLHLTTYLLALDEQYDWQASELRKCLRRAKEAEIFSRML* |
Ga0182140_10833271 | 3300015314 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTAVHLTTYLLALDEQYDRQASELRKCLWRVEEAEIFSRMLQVPREEADP* |
Ga0182140_11021571 | 3300015314 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTVVHLTAYLLVLDEQYDRQALELRSCLRRAEEAEIFNQMLQV* |
Ga0182140_11122981 | 3300015314 | Miscanthus Phyllosphere | RARMEALQGRYAQEDSLTVVHLTTYLLALDDQNHRQASELRKCLRRAEEAEIFSRMLQV* |
Ga0182127_10265211 | 3300015321 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTVVHLTTYLLALDEQYDWQALELRICLRWAEEAEIFTQML* |
Ga0182127_10388292 | 3300015321 | Miscanthus Phyllosphere | MEALQGQDAQEDSPTVVHLSTYLLALDEYYDRQALELRICLQRVAEAEIFTRIL* |
Ga0182127_10909172 | 3300015321 | Miscanthus Phyllosphere | MEALQGQNAQEDSPTVVHLTAYLLALDEQYDWQALELRTCLRRAKEAEIFSRM |
Ga0182127_11070472 | 3300015321 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTMVHLTTCLLALDEQYDQQASELRKCLWRAEEAEIFSRML* |
Ga0182110_10809941 | 3300015322 | Miscanthus Phyllosphere | GWDAQEDSPTMVYLTTYLLALDKQYDRQALELRIYLRRSEEAEIFTRMLQV* |
Ga0182110_11032231 | 3300015322 | Miscanthus Phyllosphere | QEDSPTVVHLTTYLLALDEQYNRQALELRSYLRPAEEVKIFTRML* |
Ga0182110_11085422 | 3300015322 | Miscanthus Phyllosphere | MEALQGQDAQEDSPTMVHLTTCLLALDEQYDRQASELRKCLWRAEEAKIFSRML* |
Ga0182129_10660542 | 3300015323 | Miscanthus Phyllosphere | MEALQGRDTQEDSTTVVHLTMYLLALDEQYDRQALELRICLRLAEEAEIFTRML* |
Ga0182129_10958181 | 3300015323 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTAMHLTMYLLALDEQYDQQALELRACLRRAEEAE |
Ga0182187_10761722 | 3300015341 | Miscanthus Phyllosphere | MEALQGRDAQEDSPIMVHLTTYLLALDEQYDRQALELRACLRRAEEAEIFTRMLQVQLAEAH |
Ga0182187_11020452 | 3300015341 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTVVHLTTYLLALDEQYDQQALELRICLSRAEEAEIFTRMLEV* |
Ga0182187_11033982 | 3300015341 | Miscanthus Phyllosphere | DAQEDSPTLVHLTMYLLALDEQYDRQASELKQCLRRAKEAKIFSRMLQV* |
Ga0182187_12020001 | 3300015341 | Miscanthus Phyllosphere | DAQEESPIVVHLTMCLLALDEQYDRQASELRKCLRPAEEAKIFSRML* |
Ga0182109_11224762 | 3300015342 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTMVHLTTYLLALDEQYDWQALELRKCLRQVEEAKILSRMLQV* |
Ga0182109_11451191 | 3300015342 | Miscanthus Phyllosphere | MEALQGRDAQEGSPTMVHLTMYLLALDEQYDRQASELRKCLWQAKKAKIFYKML* |
Ga0182109_11476821 | 3300015342 | Miscanthus Phyllosphere | PLEKNQRARRARMEALQGRDVQQDSPTVVYLTMYLLALDEQQDQQDLELRVCLRRAKEAEIFSRML* |
Ga0182109_11895381 | 3300015342 | Miscanthus Phyllosphere | GRDVQEDSPTVVHLTTYLLALDEQYDRQALELRSYLHRAEEAKIFTRTL* |
Ga0182109_12074052 | 3300015342 | Miscanthus Phyllosphere | LQGQDAQEDSPTMVHLTTYLLALDEQYDRQALELRACLQHAEEAKIFNRML* |
Ga0182109_12157792 | 3300015342 | Miscanthus Phyllosphere | EAQEDSPTMVHLTTYLLALDEQYDRQALELRICLQRADEIEIFTRML* |
Ga0182155_10613771 | 3300015343 | Miscanthus Phyllosphere | DKNQWAWRAHIEALQGRDVQEDSPTMVHLTTYLLALDEQYDRQALELRTCLRRAEEAEIFSKML* |
Ga0182155_10722851 | 3300015343 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTMLHLTTYLLALDEQYDWQALELRKCLRRAEEAEIFSRM |
Ga0182155_11848903 | 3300015343 | Miscanthus Phyllosphere | AWRAHIEALQGRDVQEDSPTMVHLTTYLLLDERYDRQALELRICLRRAEEAEIFTRML* |
Ga0182155_12058642 | 3300015343 | Miscanthus Phyllosphere | RDAQDDSPTMLHLTAYLLALDEQYDRQASKLRTCLRHAEEAEIFSRMLQV* |
Ga0182189_10255471 | 3300015344 | Miscanthus Phyllosphere | WRARIEALQGRDAKEDSPTVVHLTTCLLALDEQYDRQASELRKCLRRAEEAEIFSRML* |
Ga0182189_10583352 | 3300015344 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTMVHLTTYLLALDEQYDCQALELGACLRRAEEAEVFNQMLQV* |
Ga0182189_10901441 | 3300015344 | Miscanthus Phyllosphere | MGMKGSHGGLQGRDAQEDNPTVVPLTMYLLALDEQYNRQALELRTCLRRAEGAEIFSRML |
Ga0182189_11652742 | 3300015344 | Miscanthus Phyllosphere | QGRDVQDDSPTVVHLTTYLLALDEQYDQKALELRACLRRVEEAKIFNRML* |
Ga0182111_10303143 | 3300015345 | Miscanthus Phyllosphere | MEALQGQEAQEDSPTMVHLTTYLLALDEQYDRQALELRICLRRVEEAEIFTRML* |
Ga0182111_12229242 | 3300015345 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTMVHLTMYLLALDEQYDRQASELRKCLWQAKKAKIFYKML* |
Ga0182111_12300641 | 3300015345 | Miscanthus Phyllosphere | MEALQGWDVQEDSPTVVHLTTYLLALDEQYDWLALELRICLRRAEEAEIFTRML* |
Ga0182139_11828671 | 3300015346 | Miscanthus Phyllosphere | MEALQGRDVQEDNPTMVHLTTYLLALDEQYDRQALELRACLRRAEEAKIFNRMLQV* |
Ga0182139_12115752 | 3300015346 | Miscanthus Phyllosphere | MEALQGWDAQEDSPTMVHLTTYLLALDEQYDQQASELRTCLQRAKEAKIFSRML* |
Ga0182139_12282801 | 3300015346 | Miscanthus Phyllosphere | RNRRAWRARMEALQGQDAQEDSPTMVHLTTYLLVLDEKYDQQALELRICLRWAEEAKIFTRML* |
Ga0182139_12416021 | 3300015346 | Miscanthus Phyllosphere | EDSPTMVHLTTYLLALDEQYDRQALELRSCLRRAEEVEVFNRMLQV* |
Ga0182177_11998492 | 3300015347 | Miscanthus Phyllosphere | MDALQGRDVQEDNPTMVHLTTYLLALDEQYDQQASETRKCLRRAEEAKIFSRML* |
Ga0182177_12008711 | 3300015347 | Miscanthus Phyllosphere | MEALQGRDTQEDNPTVVHLTTYLLALDEQYDWQASEMRRCLHRAKEAEIFTRM |
Ga0182177_12084571 | 3300015347 | Miscanthus Phyllosphere | EDSLTVVHLTTYLFGLDEQYDRQASKLRMCLRQAKEAEIFSRML* |
Ga0182161_10335051 | 3300015351 | Miscanthus Phyllosphere | MEALQGWDAQEDSPTVVHLTTYLIALDEQYDLQASELRKCLRRAKEAEIFSRMLQV* |
Ga0182161_11136292 | 3300015351 | Miscanthus Phyllosphere | EKNQRVWRARMEALQGQDAQEDSPTMVHLTMYLLALDEQYDRHASELRKCLQRAMKAEIFSRML* |
Ga0182161_11370732 | 3300015351 | Miscanthus Phyllosphere | MEALQGRETQEDSPTGVHLTTYLVALDEQYDWQALELRTYLRRAEEAEIFT* |
Ga0182161_11738322 | 3300015351 | Miscanthus Phyllosphere | MDALQGWDTQEDSPTTVHLTTYLLALDEQYDRQALELRICLHRAEEAEILTQML* |
Ga0182159_11576931 | 3300015355 | Miscanthus Phyllosphere | MEALQGQDAQEDSPTVVHLTTYLLALDEQYDWQALELRSCLWCTEEAEVFDRML* |
Ga0182159_12203521 | 3300015355 | Miscanthus Phyllosphere | RMEALQGRDAQEDSPTVVRLATYLLALDEQYNRQALELRACLRRAEEAEIFTRMLQV* |
Ga0182159_12258031 | 3300015355 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTVMHLTTYLLALDEQYDWQALELRKCLWRVEEVEIFSRML* |
Ga0182159_13026021 | 3300015355 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTVVHLTMYLLALDEQYDRQALELRACLRRAEEAEIFTRMLQV* |
Ga0182159_13541261 | 3300015355 | Miscanthus Phyllosphere | WARMEALQGQDAQEDRPTMVHLTMYLLALDEQYDRQALELRIYLRRAEEAKIFTRMLQV* |
Ga0182145_10367022 | 3300015361 | Miscanthus Phyllosphere | EALQGRDAQEDSPTMVHLTTYLLALDEQYDHQALELRACHRRADEAEIFNRML* |
Ga0182203_10851931 | 3300017404 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTMVHLTTYLLALDEQYDRQALELRKCLRQVEEVEIFFRML |
Ga0182203_11557081 | 3300017404 | Miscanthus Phyllosphere | VQEDSPTVVHLTMYLLALDEQYDQQALELRKCLRRAEQDEIFSRLL |
Ga0182220_10203802 | 3300017407 | Miscanthus Phyllosphere | MEALQGRDVQEDSPTVVHLTTYLIALDKQYNRQVSELRKCLRRAKEAEIFSRML |
Ga0182220_10370791 | 3300017407 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTMVHLTKYLLALDEQYDRQALELRACLRRAEEAEIFTRML |
Ga0182220_10854992 | 3300017407 | Miscanthus Phyllosphere | MEAFQGRDAQEDSPTVVHLTTYLLALDEQYDRQALELRACLWCAEEAEIFNWMLQV |
Ga0182204_10514422 | 3300017409 | Miscanthus Phyllosphere | MEALQGWDAQEDSPTMVHLTMYLLALDEQYDRQALELRTCLCRAKEAKIFNRML |
Ga0182204_10696521 | 3300017409 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTVVRLTTYLLALDEQYDRQALELRACLRRAEEAEIFTRMLQVQL |
Ga0182208_10714941 | 3300017411 | Miscanthus Phyllosphere | AWRARMEALQGRDAQEDSPTVVHLTTYLLALDEQYDWQASELRKCLRRAEEAKTFSRML |
Ga0182208_10903981 | 3300017411 | Miscanthus Phyllosphere | ALQGRDAQEDSPTVVHLTTYLVALDEQYDRQASELRKCLWQAEEAEIFSRMLQVQLVESMLVR |
Ga0182222_10220322 | 3300017413 | Miscanthus Phyllosphere | MEALQGRDVQEDSPTMVHLTTYLLALDEQYDRQALELRACLRRAEEAEIFNRMLQVQLAEAHASAAAAES |
Ga0182222_10882931 | 3300017413 | Miscanthus Phyllosphere | MEALQARDAQEDSPTMVHLTMYLLALDEQYDRQASELRKCLRQAEEADIFSRML |
Ga0182222_11068671 | 3300017413 | Miscanthus Phyllosphere | DAQEDSPTVVHLTAYLLALDEQYDRQALELMICLRWAEEAEIFTRIL |
Ga0182202_10374222 | 3300017415 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTMVHLTMYLLALDEQYDRRALELRSCLHRAEEAEVFNRML |
Ga0182202_10387221 | 3300017415 | Miscanthus Phyllosphere | GWDAQEDSPTMVHLTTYLLALNEQYDWQTLKLRKYLRRAEKAEIFSRMLQV |
Ga0182202_10704873 | 3300017415 | Miscanthus Phyllosphere | RMEALQGWDAQEDSPTMVHLTTYLLALDEQYNQQALVLRVCLRRAKEAEIFNWML |
Ga0182230_10416342 | 3300017417 | Miscanthus Phyllosphere | MEALQGQDAQEDSPTMVHLTTYLLVLDEQYDRQASELRTCLRRVEEAEIFSRML |
Ga0182228_10933502 | 3300017420 | Miscanthus Phyllosphere | WRARMEDLQVGDAQENSPTVVYLARYLIALDEQYDRQASELRKCLCRAEEAEIFSRDARSATR |
Ga0182228_11019322 | 3300017420 | Miscanthus Phyllosphere | MEALQGQDAQEDSPTMVHLTTYLLALDEQYDQQALEMRTCLHRAEEAKIFTWML |
Ga0182219_10489411 | 3300017424 | Miscanthus Phyllosphere | MVALQGREAQEDSPTMVHLTMYLLALDEQYDQQALELRKCLRRAEEAKILSRML |
Ga0182219_10514083 | 3300017424 | Miscanthus Phyllosphere | RMEALQGWDAQEDNPTVVHLTMYLLALDEQYDQQASELRKCLWRAEEVEIFSRML |
Ga0182219_10974421 | 3300017424 | Miscanthus Phyllosphere | MEALQGQDAQEDSLTVVYLTTYLFGLDEQYDRQASKLRMCLRQAKEAEIFSRML |
Ga0182219_11321411 | 3300017424 | Miscanthus Phyllosphere | MEALQGQDAQEDSPTMVHLTTYLLALDEQYDRQTLELRICLRREEEAKIFNRML |
Ga0182224_10901652 | 3300017425 | Miscanthus Phyllosphere | MEAFQGRDMQEDSPTVVHLTTYLLALDEQYDRQALELGACLRRAEEAEIFNRML |
Ga0182224_10953351 | 3300017425 | Miscanthus Phyllosphere | MEALQGQDAQEDSPTVVHLTTYVLARDEQYDWQALEPRKCLRRAEEAEIFSRMLQV |
Ga0182224_11059441 | 3300017425 | Miscanthus Phyllosphere | MEALQGWDAQEDSPTMVHLTMYLLALNEQYDWQASELRKCLHRAEEAEIFSRML |
Ga0182224_11189111 | 3300017425 | Miscanthus Phyllosphere | MEALQGQDAQEDSSTVVHLTTYLLALDEQYDRQALELRICLRWAEEAEIFTQML |
Ga0182224_11595301 | 3300017425 | Miscanthus Phyllosphere | MEALQGRDVQEDSPTMVHLTTYLLALDEQYDRQALELRTCLRCAKEVEIFSRMLQV |
Ga0182190_11248931 | 3300017427 | Miscanthus Phyllosphere | MEALQIRDTQEDSPTVVHLTMYLLAMDEQYDWQALELRKCHRQAEEVEIFSRMLQ |
Ga0182190_11469392 | 3300017427 | Miscanthus Phyllosphere | RARMEALQGRDAQEDSPTMVHLTTYLLALDEQYDRQALELRKCLRQVEEVEIFFRML |
Ga0182192_10850152 | 3300017430 | Miscanthus Phyllosphere | MEALQGQDAQEDISTMVHLTTYLLALDEQYDRQALELRKYLRRAEEAEIFSRML |
Ga0182192_11599871 | 3300017430 | Miscanthus Phyllosphere | MEALQGRDAQEDCLIVVHLTTYLLALDEQYDRQAIELGACLRRTEEAEIFNRMLQVQLAEAHASA |
Ga0182206_10376971 | 3300017433 | Miscanthus Phyllosphere | ALQGRDTQEDSPTVVYLTTYLLALDEQYDWQALELRACLQRADEAEIFNRMLQV |
Ga0182206_10612331 | 3300017433 | Miscanthus Phyllosphere | MARIEALQGRDAQEDSPTVVHLTTYLLALDEQYDRQALELEACLWRAKEAEIFNRML |
Ga0182209_10436271 | 3300017436 | Miscanthus Phyllosphere | QGWDAQEDSPTMVHLTMYLLALDEQYDQQALELRKCLRQAKEAEIFSKML |
Ga0182209_10557942 | 3300017436 | Miscanthus Phyllosphere | MEALQGWDAQEDSPTVVHLTTYLLTLDEQYDWQVSELRKCLCRTEEAGIFSRML |
Ga0182191_10612252 | 3300017438 | Miscanthus Phyllosphere | WARMEALQGQDAQEDSPTVVHLTMYLLALDEQYDRQASELRKCLRPAEEAKIFSRML |
Ga0182191_11132061 | 3300017438 | Miscanthus Phyllosphere | MEALQGRDAHEDSPTVVHLTTYLLALDEQYNRQALELGACLRRAEEAEIFNRM |
Ga0182191_11258012 | 3300017438 | Miscanthus Phyllosphere | MEALQRRDAQEDSPTVVHLTTYLLALDEQYDRQALEMTACLRCAKEAEVFSRML |
Ga0182191_11354552 | 3300017438 | Miscanthus Phyllosphere | RAHMEALQGRDAQEDSPTVVHLTTHLLALDEQYDRQALELRICLQWAEEAEIFSRML |
Ga0182191_11660191 | 3300017438 | Miscanthus Phyllosphere | MEALQGWDAQEDSPTMVHLTTYLLALDEQYDQQALELRIYLRWAEEAEIFTQMLQVQLVK |
Ga0182221_10584752 | 3300017442 | Miscanthus Phyllosphere | MEALQGQNAQEDSPTMVHLTTYLLALDEQYDWQTLELRACLRRIEEAEIFTQMLQVQLVETHASAAAAES |
Ga0182221_10827331 | 3300017442 | Miscanthus Phyllosphere | MEALQGRDAQEDSPIAVHLTMYLLALDEQYDQQALELRIYLRRSEKVEIFTRML |
Ga0182221_11691861 | 3300017442 | Miscanthus Phyllosphere | MEALQGRDAQEDSSTTVHLTTYLLALDEQYDWQASELRKCLRRAKEAEIFSMML |
Ga0182193_10295442 | 3300017443 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTAVHLTTYLLALDEQYDWQALELRKCLRQVEEAKILSRMLQV |
Ga0182193_11169611 | 3300017443 | Miscanthus Phyllosphere | MEALQGWDAQENSPTMVHLTMNLLQFDRQASELRKCLRRAEEDEIFS |
Ga0182193_11909871 | 3300017443 | Miscanthus Phyllosphere | MEALQGRDTQEDSPTMVHLATYLIALDEQYDWQASELRKCLCRTEEAGIFSRMLQV |
Ga0182193_11947551 | 3300017443 | Miscanthus Phyllosphere | ARMEALQGRDMQEYSPIVVHLAMYLLALDEQYDRQALELRSYLRRAEEAEIFNQMLQV |
Ga0182233_10198192 | 3300017680 | Miscanthus Phyllosphere | CMEALQGHDAQEDSPTVVHLTMYLLALDEQYDRQALERRACLRHAEEAEIFNQMLQV |
Ga0182233_10877621 | 3300017680 | Miscanthus Phyllosphere | KNRRAWRTRMEALQGRDAQEDSPTVVHLTTYLLAMDEQYDRQALELRMCHHQVEEAEIFSRML |
Ga0182233_10988712 | 3300017680 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTVVHLTAYLLALDEQYDRQALELRICLRQVEEAKIFTRIL |
Ga0182229_10771372 | 3300017682 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTMVHLTMYLLALDEQYDRQASELRKCLRRAKEAKIFSRMLQV |
Ga0182218_10392182 | 3300017683 | Miscanthus Phyllosphere | KARLEALQGQDAQVDSPSMVHLTMYLLALDEQYDWQASELRKCLWRAKEAEIFSRML |
Ga0182218_10436631 | 3300017683 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTVVHLTTYLIALDEQYDRQASELRKCLRRAQEAEIFSMMLQV |
Ga0182218_11374941 | 3300017683 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTVVHLTTYLLALDEQYDRQALELRICLRRAEEAEIFTRM |
Ga0182225_10784241 | 3300017684 | Miscanthus Phyllosphere | EDSPTVVHLTTHLLALDEQYDRQASELRKCLRRAEEAEIFSRML |
Ga0182225_11116742 | 3300017684 | Miscanthus Phyllosphere | MEALQGWDAQEDSPIVVHLTTYLLALDEQYDRQASELRKCLRRPEEAEIFSRML |
Ga0182227_10733622 | 3300017685 | Miscanthus Phyllosphere | RMEALQGRDAQEDSPTVVHLTTYLLALDEQYDWQALELRACLWRAEEAEIFTRML |
Ga0182227_11336221 | 3300017685 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTVVHLTMYLLALDEQYDRQALEMRKCLHRAEEAKIFTRML |
Ga0182227_11360521 | 3300017685 | Miscanthus Phyllosphere | MEALQGRDAQEDSPTVVHLTMYLLALDEQYDRQALELGACLRHAEEAEIFNRML |
Ga0182205_10283651 | 3300017686 | Miscanthus Phyllosphere | EALQGWESQEDSPTMVHLTTYLLALDEQYDRQALELRICLHRAEEAEIFTRMLKV |
Ga0182231_10699592 | 3300017689 | Miscanthus Phyllosphere | MEAFQGRDAQEDSPTAVHLTTYLVALDEQYDRQASELKKCLRRAEEAEIFFRML |
Ga0182223_10257021 | 3300017690 | Miscanthus Phyllosphere | MEALQGRDAQEDGPTTVHLTMYMLALDEQYDQQASELRKCLRRTEEAEIFSRM |
Ga0182223_10682711 | 3300017690 | Miscanthus Phyllosphere | MEALQGWDAQEDSPTVVPLTTYLLALDEQYDRQALELRVCLRRAEEAEIFNRML |
Ga0182223_10792281 | 3300017690 | Miscanthus Phyllosphere | MEALQGRDAKENSPTMVHLTTYLLALDEQYGRQVSEMWKCLRRAEE |
⦗Top⦘ |