Scaffold Ga0182006_1309081

Overview

Basic Information

• Taxon OID: 3300015261
• Scaffold ID: Ga0182006_1309081
• Source Dataset Name: Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 519
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Sorghum-Associated Microbial Communities From Plants Grown In Nebraska, Usa

Source Dataset Sampling Location

• Location Name: USA: Nebraska
• Coordinates
  • Lat. (^o): 41.1591
  • Long. (^o): -96.4086

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097998	Metagenome / Metatranscriptome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0182006_13090812	F097998	AGGA	MALFFHSDDVDQLISFKEAIEITESALRDLVSPRGVNAPRKRLNLHRDIAEGSFD