Scaffold Ga0182874_10003310

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0182874_10003310

Scaffold Ga0182874_10003310

Overview

Basic Information
Taxon OID	3300015215 Open in IMG/M
Scaffold ID	Ga0182874_10003310 Open in IMG/M
Source Dataset Name	Freshwater microbial mat microbial communities from Canadian High Arctic Lake, Ward Hunt Island , Canada - Sample WHb
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Laval University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1371
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Subglacial Lake → Unclassified → Microbial Mat → Microbial Mat Communities From High Arctic Lakes

Source Dataset Sampling Location
Location Name	Canada: Nunavut
Coordinates	Lat. (^o)	83.079722	Long. (^o)	-74.138056	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040635	Metagenome / Metatranscriptome	161	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0182874_100033102	F040635	N/A	VRDEDIPDINNPKTMKAVAEGDKLMKEVLNGGYNVHPVP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.