3300015215: Freshwater microbial mat microbial communities from Canadian High Arctic Lake, Ward Hunt Island , Canada - Sample WHb

Overview

Basic Information

• IMG/M Taxon OID: 3300015215
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128895 | Gp0209313 | Ga0182874
• Sample Name: Freshwater microbial mat microbial communities from Canadian High Arctic Lake, Ward Hunt Island , Canada - Sample WHb
• Sequencing Status: Permanent Draft
• Sequencing Center: Laval University
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 912092833
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → Aquabacterium pictum	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Microbial Mat Communities From High Arctic Lakes
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Subglacial Lake → Unclassified → Microbial Mat → Microbial Mat Communities From High Arctic Lakes

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater lake biome → subglacial lake → microbial mat material
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Surface (non-saline)

Location Information

• Location: Canada: Nunavut
• Coordinates
  • Lat. (^o): 83.079722
  • Long. (^o): -74.138056
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001089	Metagenome / Metatranscriptome	781	Y
F040635	Metagenome / Metatranscriptome	161	Y
F050165	Metagenome / Metatranscriptome	145	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0182874_10003310	All Organisms → cellular organisms → Eukaryota → Sar	1371
Ga0182874_10019120	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → Aquabacterium pictum	674
Ga0182874_10024898	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	609

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0182874_10003310	Ga0182874_100033102	F040635	VRDEDIPDINNPKTMKAVAEGDKLMKEVLNGGYNVHPVP
Ga0182874_10019120	Ga0182874_100191201	F050165	MNPTFERALWASTPALRCLAPLDAILAPALGLYWIKTLPASGGLVGAVLGVFCLWIGARRAYRALFEFEAYRWMTLRLAKLAIATWVVMAMVKLVWFIQGSL*
Ga0182874_10024898	Ga0182874_100248981	F001089	VTAGESDYLLRLAALSLSFVGFSAVVVTLRGALGGEIADRHLRLVRLYIEGGLLVTALALVPTLLTLLHIPDTVIWPVSSATAAAILTFVLLIQFRRRRTVEPGRFPPWVIIIYAVSIGAVAALWLNVVGIPFAPSVGPYAAALTWALCVFGFIFVRTIDVFLHRPPPG*